KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4953Help
Entry
ECH74115_4953     CDS       T00778                                 

Definition
(GenBank) MltA-interacting protein MipA
  KO
K07274  MipA family protein
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecf02000]
    ECH74115_4953
Transporters [BR:ecf02000]
 Other Transporters
  Others
   ECH74115_4953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MipA
Motif
Other DBs
NCBI-ProteinID: ACI35071
Position
complement(4595566..4596306)
Genome map
AA seq 246 aa AA seqDB search
MLINRNIVALFALPFMASATASELSIGAGAAYNESPYRGYNENTKAIPLISYEGDSFYVR
QTTLGFILSQSEKNELSLTASWMPLEFDPADNDDYAMQQLDKRDSTAMAGVAWYHHERWG
TVKASAAADVLDNSNGWVGELSVFHKMQIGRLSLTPALGVLYYDENFSDYYYGISESESR
RSGLASYSAQDAWVPYVSLTAKYPIGEHVVLMASAGYSELPEEITDSPMIDRNESFTFVT
GVSWRF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttaattaaccgcaatattgtggcgttatttgcgttgccttttatggcaagcgcaact
gcttctgaattatccattggtgctggtgcggcttataatgaatcgccttatcgcggttat
aatgaaaatacaaaggcaattccgctgattagttatgaaggtgattctttttatgttcgt
cagaccacgttaggttttattctgtcgcaaagtgaaaaaaatgaacttagcctgaccgca
tcctggatgccgctggaatttgaccctgccgataatgacgattatgccatgcaacagctt
gataagcgtgatagtacggctatggcgggggttgcctggtatcaccacgagcgttgggga
accgtgaaagcctctgcagctgcggacgttctggataacagcaacggctgggtgggggag
ctatcggtattccacaaaatgcagataggtcgtctgtcgctgacacctgcgctgggcgtt
ctctattatgacgagaatttcagtgactattactatggcatttcagagagtgagtcccgt
cgtagcggtctggcaagttattccgcgcaggatgcctgggtgccctatgtcagcctgacg
gcaaaatacccgataggagagcacgtcgtattgatggcgagcgcaggatacagcgagctg
ccggaagagattaccgacagcccgatgattgatcgtaatgagagttttacctttgtcacc
ggcgtgagctggcgtttttaa

DBGET integrated database retrieval system