KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4954Help
Entry
ECH74115_4954     CDS       T00778                                 

Definition
(GenBank) auxiliary transport protein, membrane fusion protein (MFP) family
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD HlyD_D23 Biotin_lipoyl_2 HlyD_3 TolA_bind_tri Leu_zip CENP-Q
Motif
Other DBs
NCBI-ProteinID: ACI39807
Position
complement(4597401..4598537)
Genome map
AA seq 378 aa AA seqDB search
MDLLIILTYVAFAWAMFKIFKIPVNKWTIPTAALGGIFIVSGLILLMNYNHPYTFKAQKA
VISIPVVPQVTGVVIEVTDKKNTLIKKGEVLFRLDPTRYQARVDRLMADIVTAEHKQRAL
GAELDEMAANTQKAKATRDKFAKEYQRYARGSQAKVNPFSERDIDVARQNYLAQEASVKS
SAAEQKQIQSQLDSLVLGEHSQIASLKAQLAEAKYNLEQTIVRAPSDGYVTQVLIRPGTY
AASLPLRPVMVFIPDQKRQIVAQFRQNSLLRLAPGDDAEVVFNALPGKVFSGKLAAISPA
VPGGAYQSTGTLQTLNTAPGSDGVIATIELNEHTDLSALPDGIYAQVAVYSDHFSHVSVM
RKVLLRMTSWVHYLYLDH
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggatttactgattattttgacctatgtggcttttgcatgggcaatgtttaagatcttc
aaaattcccgtaaataaatggaccattcccacagcggccctgggtggaatatttattgtc
agcggtctaattctgttaatgaactataaccatccgtatacctttaaagcgcaaaaagcg
gttatttctattcctgttgtcccacaggtgacaggcgtggtgatagaagtgacggataag
aaaaatacgctgattaaaaaaggtgaggtgctatttcgactggacccgacgcgttatcag
gcgcgggtggatcggctgatggcggatatcgttaccgcagaacataaacagcgggcgttg
ggcgcagagttagatgagatggcggcgaatactcagaaggcaaaggccacgcgggataaa
ttcgctaaggagtaccagcgttacgcacgcggcagccaggcgaaagtaaacccgttttca
gaacgcgatattgatgtggcacggcaaaattatctggcgcaggaagcctccgtaaagtca
tcggcggcggaacaaaaacagatccagagccagctggatagcctggtgttgggtgaacat
tctcaaatcgccagcctgaaagcgcagctcgcggaagcaaaatataaccttgagcagacg
atagtgcgtgcgccgagcgatggttatgtgacccaagtgctgattcgtccgggtacctat
gccgcgtcgctgccgctacgtccggtgatggtgtttatacccgatcagaaacgacaaatc
gtggcgcagttccgtcagaactccttgctgcgcctggctcccggcgatgatgcggaagtg
gtatttaacgctctgccaggcaaagtgttcagcggtaagctggcagccattagtccagct
gttcccggcggagcttatcagtcgaccggcaccttacagacgttaaacacagcgccgggt
tcagatggcgttatcgcgaccattgaactgaatgagcacactgatttgagcgctttacca
gacggtatttacgctcaggtggcggtctactctgatcatttcagccatgtctcggtgatg
cgcaaagtgttattacgcatgaccagctgggtgcattacctttatctcgatcattaa

DBGET integrated database retrieval system