KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4955Help
Entry
ECH74115_4955     CDS       T00778                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-ProteinID: ACI37650
Position
4596430..4597404
Genome map
AA seq 324 aa AA seqDB search
MTKLQLKYRELKIISVIAASENISHAATVLGIAQANVSKYLADFESKVGLKVFDRTTRQL
MLTLFGTALLPYINDMLDRNEQLNNFIADYKHEKRGRVTIYAPTGIITYLSKHVIDKIKD
IGDITLSLKTCNLERNAFYEGVEFPDDCDVLISYAPPKDESLVASFITQYAVTAYASQRY
LEKHPISRPDELEHHSCILIDSMMIDDANIWRFNVAGSKEVRDYRVKGNYVCDNTQSALE
LARNHLGIVFAPDKSVQSDLQDGTLVPCFQHPYEWWLDLVAIFRKREYQPWRVQYVLDEM
LREIRHQLAQSQQLRPEQAAESED
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaattacaacttaagtaccgggagttaaaaattatctcggtaatcgctgccagt
gaaaatatcagccatgccgcgactgtacttggcatcgcacaggccaacgtcagcaaatat
cttgctgattttgaatcaaaagtgggtttaaaagtctttgaccgaaccacccgacaactg
atgctcacactttttggcaccgcgctattaccgtacatcaacgacatgctggacagaaac
gagcagcttaataattttattgcagattataagcatgagaaacgtggtcgggtcaccatc
tacgccccaaccggcataattacctatttatccaaacatgtaatcgataaaattaaagat
atcggtgatatcaccttatcgctaaaaacctgcaatcttgagcgtaatgccttttatgaa
ggcgtcgaatttcctgatgattgtgatgttttaatcagctatgccccaccaaaagatgaa
tcgctggttgccagttttattacccaatatgccgtaaccgcttatgccagccagcgctat
cttgagaaacatcctattagccgtcctgacgaactcgaacatcactcctgtattttgatc
gactcgatgatgatcgacgacgcgaatatctggcgcttcaacgtcgccgggagtaaagag
gtgcgggattatcgcgtgaagggaaattacgtttgcgataacacgcaatcggcgctggag
ctggcacgaaatcacctggggattgtgtttgcgccagacaaaagtgtgcagagcgatctg
caagacggcacgctggtgccctgctttcagcacccgtatgaatggtggctggatctggtg
gctatcttccgtaaacgggaataccagccctggcgggtccagtatgtgctggatgaaatg
ctgcgtgaaattcgccaccagcttgctcagtcgcagcaactgcggcctgaacaagcggcg
gaaagcgaagattaa

DBGET integrated database retrieval system