KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4958Help
Entry
ECH74115_4958     CDS       T00778                                 

Gene name
aldB
Definition
(GenBank) aldehyde dehydrogenase B
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00010  Glycolysis / Gluconeogenesis
ecf00620  Pyruvate metabolism
ecf01100  Metabolic pathways
ecf01110  Biosynthesis of secondary metabolites
ecf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECH74115_4958 (aldB)
   00620 Pyruvate metabolism
    ECH74115_4958 (aldB)
Enzymes [BR:ecf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     ECH74115_4958 (aldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACI36746
Position
complement(4599411..4600949)
Genome map
AA seq 512 aa AA seqDB search
MTNNPPSAQIKPGEYGFPLKLKNRYDNFIGGEWVAPADGEYYQNLTPVTGQLLCEVASSG
KRDIDLALDAAHKVKDKWAHTSVQDRAAILFKIADRMEQNLELLATAEAWDNGKPIRETS
AADVPLAIDHFRYFASCIRAQEGGISEVDSETVAYHFHEPLGVVGQIIPWNFPLLMASWK
MAPALAAGNCVVLKPARLTPLSVLLLMEIVGDLLPPGVVNVVNGAGGEIGEYLATSKRIA
KVAFTGSTEVGQQIMQYATQNIIPVTLELGGKSPNIFFADVMDEEDAFFDKALEGFALFA
FNQGEVCTCPSRALVQESIYERFMERAIRRVESIRSGNPLDSVTQMGAQVSHGQLETILN
YIDIGKKEGADVLTGGRRKLLEGELKDGYYLEPTILFGQNNMRVFQEEIFGPVLAVTTFK
TMEEALELANDTQYGLGAGVWSRNGNLAYKMGRGIQAGRVWTNCYHAYPAHAAFGGYKQS
GIGRETHKMMLEHYQQTKCLLVSYSDKPLGLF
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaccaataatcccccttcagcacagattaagcccggcgagtatggtttccccctcaag
ttaaaaaaccgctatgacaactttattggcggcgaatgggtagcccctgccgatggtgag
tattaccagaacctgacgccggtgaccgggcagctgctgtgcgaagtggcgtcttcgggc
aaacgagacatcgatctggcgctggatgctgcgcacaaagtgaaagataaatgggcgcac
acctcggtgcaggatcgcgcggcgattctgtttaagattgccgatcgaatggaacaaaac
ctcgagctgttagcgacagctgaagcctgggataacggcaaacccattcgcgaaaccagt
gctgcggatgtaccgctggcgattgaccatttccgctatttcgcctcgtgtattcgggcg
caggaaggtgggatcagtgaagttgatagcgaaaccgtggcctatcatttccatgaaccg
ttaggcgtggtggggcagattatcccgtggaacttcccgctgctgatggcgagctggaaa
atggctcccgcgctggcggcgggcaactgtgtggtgctgaaacccgcacgtcttaccccg
ctttctgtactgctgctaatggaaatcgtcggtgatttactgccgccgggcgtggtgaac
gtggtcaacggtgcaggtggggaaattggcgaatatctggcgacctcgaaacgcatcgcc
aaagtggcgtttaccggctcaacggaagtgggtcaacaaattatgcaatacgccacgcaa
aacattattccggtgacgctggagctgggcggtaagtcgccaaatatcttctttgctgat
gtgatggatgaagaagatgcctttttcgataaagcgctggaaggctttgcactgtttgcc
tttaaccagggcgaagtttgcacctgtccgagtcgtgccttagtgcaggagtcaatctac
gaacgctttatggaacgcgccatccgccgtgtcgaaagcattcgcagcggtaacccactc
gacagcgtgacgcaaatgggtgcgcaggtttctcacgggcaactggaaaccatcctcaac
tacattgatatcggtaaaaaagagggcgctgatgtgctcaccggcgggcggcgcaagctg
ctggaaggtgaactgaaagacggctactacctcgaaccgacgattctgtttggtcagaac
aatatgcgcgtgttccaggaggagatttttggcccggtgctggcggtgactaccttcaaa
acgatggaagaagcgctggagctggcgaacgatacgcaatatggcctgggcgcgggcgtc
tggagccgcaacggtaatctggcctataagatggggcgcggcatacaggctgggcgcgtg
tggaccaactgttatcatgcttacccggcacatgcggcgtttggtggctacaaacaatca
ggtatcggtcgcgaaacccacaagatgatgctggagcattaccagcaaaccaagtgcctg
ctagtgagctactcagataaaccgttggggctgttctga

DBGET integrated database retrieval system