KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4962Help
Entry
ECH74115_4962     CDS       T00778                                 

Gene name
selA
Definition
(GenBank) L-seryl-tRNA selenium transferase
  KO
K01042  L-seryl-tRNA(Ser) seleniumtransferase [EC:2.9.1.1]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00450  Selenocompound metabolism
ecf00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECH74115_4962 (selA)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ECH74115_4962 (selA)
Enzymes [BR:ecf01000]
 2. Transferases
  2.9  Transferring selenium-containing groups
   2.9.1  Selenotransferases
    2.9.1.1  L-seryl-tRNASec selenium transferase
     ECH74115_4962 (selA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SelA Se-cys_synth_N Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ACI36031
UniProt: B5YW91
Position
complement(4605663..4607054)
Genome map
AA seq 463 aa AA seqDB search
MTTETRSLYSQLPAIDRLLRDSSFLSLRDTYGHTRVVELLRQMLDEAREVIRGSQTLPAW
CENWAQEVDARLTKEAQSALRPVINLTGTVLHTNLGRALQAEAAVEAVAQAMRSPVTLEY
DLDDAGRGHRDRALAQLLCRITGAEDACIVNNNAAAVLLMLAATASGKEVVVSRGELVEI
GGAFRIPDVMRQAGCTLHEVGTTNRTHANDYRQAVNENTALLMKVHTSNYSIQGFTKAID
EAELVALGKELDVPVVTDLGSGSLVDLSQYGLPKEPMPQELIAAGVSLVSFSGDKLLGGP
QAGIIVGKKEMIARLQSHPLKRALRADKMTLAALEATLRLYLHPEALSEKLPTLRLLTRS
AEVIQIQAQRLQAPLAAHYGAEFAVQVMPCLSQIGSGSLPVDRLPSAALTFTPHDGRGSH
LESLAARWRELPVPVIGRIYDGRLWLDLRCLEDEQRFLEMLLK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgaaacgcgttccctctatagtcaacttccggctattgatcgcttattgcgc
gatagctccttcctttctttgcgtgatacttatggtcacacccgcgtggtggaattgttg
cgtcagatgctcgacgaagcgcgagaagtgattcgtggcagccagacgctgcctgcgtgg
tgtgaaaactgggcgcaagaagtcgatgcccggttgacgaaagaagcgcagagcgcgctg
cgtccggtgatcaacctgacgggaaccgtgctgcataccaaccttgggcgagctttacag
gcggaagccgcggtggaagccgttgcgcaggctatgcgttcgccagtgaccctcgagtac
gatctggacgacgccggacgcggacatcgcgatcgggcgctggcgcagctgctgtgccgt
attacgggggcggaagatgcctgtatcgtcaataacaatgcggcggcggtgttattgatg
ttggcggccactgccagcggaaaagaggtggtggtatctcgcggcgaactggtggagatt
ggcggcgcgtttcgtattcccgatgttatgcgtcaggcaggctgcaccctacacgaagta
gggaccaccaaccgcacgcacgcgaatgattatcgtcaggcggtgaatgaaaataccgca
ctgttgatgaaagtacataccagtaactacagcattcaggggttcaccaaagcgatagat
gaagcggaactggtggcgctcggcaaagagctggatgttcccgtagtgactgatttaggc
agtggctcgctggtcgatcttagccagtacggtttgccgaaagagccaatgccgcaggag
ttgattgcggcgggcgtcagtctggtgagcttctccggcgacaagttgttaggcgggccg
caggcagggattatcgttggtaaaaaagagatgatcgcccgcctgcaaagccacccgctg
aagcgtgcattacgcgcggataaaatgaccctcgcggcgctggaagccacgttgcgtctt
tatttacaccctgaagctctgagtgaaaaattaccgaccctgcgcctgcttacccgcagc
gcagaggtcattcaaatccaggcacaacgtttacaggctccccttgccgcacattacggc
gcggagtttgcggtacaggttatgccatgtctttcgcagattggcagtggttcgctgccg
gttgatcgcctgccgagcgcggcattaacgtttacaccccatgatggacgcggtagccac
cttgagtcattagccgcccgctggcgtgaattgccagtgccggtgattggtcgtatttat
gacggacgattgtggctggatttacgctgccttgaagatgagcaacggtttttggagatg
ttgttgaaatga

DBGET integrated database retrieval system