KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4965Help
Entry
ECH74115_4965     CDS       T00778                                 

Definition
(GenBank) Rhs family protein
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RHS_repeat RHS
Motif
Other DBs
NCBI-ProteinID: ACI35124
Position
4607989..4612218
Genome map
AA seq 1409 aa AA seqDB search
MSGKPAARQGDMTQYGGSIVQGSAGVRIGAPTGVACSVCPGGVTSGHPVNPLLGAKVLPG
ETDIALPGPLPFILSRTYSSYRTKTPAPVGSLGPGWKMPADIRLQLRDNTLILSDNGGRS
LYFEHLFPGEDGYSRSESLWLVRGGVAKLDEGHRLAALWQALPEELRLSPHRYLATNSPQ
GPWWLLGWCERVPEADEVLPAPLPPYRVLTGLVDRFGRTQTFHREAAGEFSGEITGVTDG
AGRHFRLVLTTQAQRAEEARQQAISGGTEPSAFPDTLPGYTEYGRDNGIRLSAVWLTHDP
EYPENLPAAPLVRYGWTPRGELAVVYDRSGKQVRSFTYDDKYRGRMVAHRHTGRPEIRYR
YDSDGRVTEQLNPAGLSYTYQYEKDRITITDSLNRREVLHTQGEGGLKRVVKKEHADGSV
TQSQFDAVGRLRAQTDAAGRTTEYSPDVVTGLITRITTPDGRASAFYYNHHSQLTSATGP
DGLEIRREYDEWGRLIQETAPDGDITRYRYDNPHSDLPCATEDATGSRKTMTWSRYGQLL
SFTDCSGYVTRYDHDRFGQMTAVHREEGLSQYRAYDSRGQLIAVKDTQGHETRYEYNAAG
DLTTVIAPDGSRNGTQYDAWGKAICTTQGGLTRSMEYDAAGRVIRLTSENGSHTTFRYDV
LDRLIQETGFDGRTQRYHHDLTGKLIRSEDEGLVTHWHYDEADRLTHRTVKGETAERWQY
DERGWLTDISHISEGHRVTVHYGYDEKGRLTGERQTVHHPQTEALLWQHETRHAYNAQGL
ANRCIPDSLPAVEWLTYGSGWLAGMKLGDTPLVDFTRDRLHRKTLRRFGRYELTTAYTPA
GQLQSQHLNSLQYDRDYTWNDNGELIRISSPRQTRSYSYSDSGRLTGVHTTAANLDIRIP
YATDPAGNRLPDPELHPDSTLSMWPDNRIARDAHYLYWYDRHGRLTEKTDLIPEGVIRTD
DERTHRYHYDSQHRLVHYTRTQYEEPLVESRYLYDPLGRRVAKRVWRRERDLTGWMSLSR
KPQVTWYGWDGDRLTTIQNDRTRIQTIYQPGSFTPLIRVETATGELAKTQRRSLADALQQ
SGGEDGGSVVFPPVLVQMLDRLESEILADRVSEESRRWLASCGLTVAQMQSQMDPVYTPA
RKIHLYHCDHRGLPLALISKEGATEWCAEYDEWGNLLNEENPHQLQQLIRLPGQQYDEES
GLYYNRHRYYDPLHGRYITQDPIGLKGGWNFYQYPLNPVINVDPQGLVDINLYPESDLIH
SVADEINIPGVFTIGGHGTPTSIESATRSIMTAKDLAYLIKFDGNYKDGMTVWLFSCNTG
KGQNSFASQLAKELHTNVIGPDTLWTWWGRGTNGKLKMDTVLTAPTNLNSNKDLMAITTK
DLGNWITYGPSGHPISNMQGTPEKPSDIR
NT seq 4230 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaaaaccggcggcgcgtcagggcgacatgacgcagtatggcggtagcattgtt
cagggttcagccggggtgcgcattggtgcccccaccggcgtggcctgttcggtgtgcccc
ggcggagtgacgtccggccatccggtcaatcccctgctcggtgcaaaggtccttcccggt
gaaaccgacatcgccctgcccggcccgctgccgttcatcctctcccgcacctacagcagt
taccggacaaaaacgcccgcgccggtggggagcctcggccccggctggaaaatgcctgcg
gatatccgcttacagctgcgcgataacacactgatactcagtgataacggcggcagaagc
ctgtattttgagcacctgtttcccggtgaggacggttacagccgcagcgagtcactctgg
ctggtgcgcggcggcgtggcgaaactggatgaaggtcaccggctggccgcactctggcag
gcgctgccggaagaactccgcttaagtccgcatcgttatctggcgacaaacagtccgcag
gggccgtggtggctgctcggctggtgtgagcgggtgccggaagcggatgaggtgctgcct
gcgccgctgccgccgtaccgggtactgaccgggctggtggaccgcttcgggcgcacacag
acgttccaccgcgaagccgccggtgaattcagcggcgaaatcaccggcgtgacggatggt
gccgggcgtcacttccggctggtactgaccacgcaggcgcagcgggcagaagaagcccgg
cagcaggccatttccggcgggacggaaccgtccgcttttcctgataccctgccgggttac
accgaatatggccgggacaacggcatccgtctgtctgccgtgtggctgacgcacgacccg
gaatacccggagaatttacctgccgcgccgctggtgcgctatggctggacgccgcgcggc
gaactggcggtggtgtatgaccgtagtggcaaacaggtgcgcagctttacttacgatgat
aaataccggggccggatggtggcgcaccgtcacacgggccggccggaaatccgttaccgt
tacgacagcgacgggcgggtgacagaacagctaaacccggcaggcttaagctacacgtat
cagtatgagaaagaccgcatcaccatcaccgacagcctgaaccgccgtgaagtcctgcac
acgcagggtgaaggcgggctgaagcgggtggtgaaaaaggaacacgcggacggcagcgtc
acgcagagtcagtttgacgcggtgggcaggctcagggcacagacggatgccgcaggcagg
acaacagaatacagcccggatgtggtgacgggcctcatcacgcgcatcaccacgccggat
ggcagggcatcggcgttttactataaccaccacagccagttaacgtcagccaccgggcct
gacgggctggaaatacgccgggaatatgatgaatggggccgtctgattcaggaaactgcc
cctgacggcgatatcacccgctaccgttatgataatccacacagtgacttaccctgcgca
acggaagatgccaccggcagccggaaaaccatgacgtggagccgttacggtcagttgctg
agcttcaccgactgttccggttatgtaacccgttatgaccatgaccgcttcgggcagatg
acggcggtgcaccgcgaggaagggctgagtcagtaccgcgcatacgacagccgtggacag
ttaattgccgtgaaagacacgcagggccatgaaacgcggtatgaatacaacgccgccggt
gacctgaccaccgtcattgccccggacggcagcagaaacgggacacagtacgatgcgtgg
ggaaaagccatctgtaccacgcagggcggtctgacgcgcagtatggaatacgatgctgcc
ggacgggtcatccgcctgaccagtgaaaacggcagccacaccaccttccgttacgatgta
ctcgaccggctgatacaggaaaccggctttgacggccgcacacagcgttatcaccacgac
ctgaccggcaaacttatccgcagcgaggatgaggggctggtcacccactggcactatgac
gaagcagaccgcctcacgcaccgcaccgtgaagggtgaaaccgcagagcgctggcagtat
gacgaacgcggctggctgacagacatcagccatatcagcgaagggcaccgggtgacggtg
cattacgggtatgatgagaaaggccggctgaccggtgagcgtcagacggtgcatcacccg
cagacggaagcactgctctggcagcatgagaccagacacgcttacaacgcgcaggggctg
gcgaaccgctgtataccggacagcctgcccgccgtggaatggctgacctatggcagcggc
tggctggcaggcatgaagctcggcgacacaccgctggtggatttcacccgcgaccgcctg
caccggaaaacgctgcgcagattcggccgttatgaactcaccaccgcttatacccctgcc
gggcagttacagagccagcacctgaacagcctgcagtatgaccgcgattacacctggaac
gacaacggcgaactcatccgcatcagcagcccgcgccagacccggagttacagctacagc
gactccggcaggctgaccggcgttcacaccaccgcagcgaatctggatatccgcatcccg
tatgccacggacccggcaggtaaccgcctgcccgacccggagctgcacccggacagcacc
ctcagcatgtggccggataaccgtatcgcccgtgacgcgcactatctttactggtatgac
cgtcacggcaggctgacagagaaaaccgacctcatcccggaaggggttatccgcacggat
gatgagcggactcaccggtaccattacgacagtcagcaccggctggtgcactacacgcgg
acacaatatgaagagccgctggtcgaaagccgctatctttacgacccgctgggccgcagg
gtggcaaaacgggtgtggcgacgtgaacgggacctgacgggctggatgtcgctgtcacgg
aaaccgcaagtgacctggtacggctgggacggcgaccggctgaccacaatacagaacgac
agaacccgcatccagacgatttatcagccggggagcttcacgccactcatcagggttgaa
accgccaccggtgagctggcgaaaacgcagcgccgcagcctggcggatgcgcttcagcag
tccggcggcgaagacggtggcagtgtggtgttcccgccggtgctggtgcagatgctcgac
cggctggaaagtgaaatcctggctgaccgggtgagtgaggaaagccgccgctggctggca
tcgtgcggcctgactgtggcgcagatgcaaagccagatggacccggtatacacgccggcg
cgaaaaatccacctgtaccactgcgaccatcgcggcctgccgctggcccttatcagtaag
gaaggggcaacagaatggtgcgcagaatacgatgagtggggcaacctgctgaatgaagag
aacccgcatcagctgcagcagcttatccgcctgccggggcagcagtatgatgaggagtcc
ggcctgtattacaaccgccaccgctattatgacccgctgcacgggcgatatatcactcag
gatccgattggactgaaggggggatggaatttttatcagtatccgttgaatccggtcata
aatgtagatccgcaaggtttggttgatataaatttataccccgaaagtgatcttatccat
tctgtagctgatgagattaatatcccaggcgttttcacaatcggggggcatggtaccccc
acatctattgaatccgcaacgcgcagtatcatgacagctaaagatctagcatatctaatt
aaatttgatgggaattataaagatgggatgacagtttggttattttcttgtaatacaggt
aaaggacaaaattcatttgctagccaattagctaaagagttacatacaaatgtaatagga
cctgacacgctatggacgtggtgggggcgaggaactaatggtaagttaaaaatggataca
gtgctaacagcaccaacgaaccttaattcaaataaggatctaatggctataacaacaaaa
gaccttggtaattggataacatatgggccatctgggcaccccatttctaatatgcaaggt
acgccagaaaaacccagtgatataagatag

DBGET integrated database retrieval system