KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4969Help
Entry
ECH74115_4969     CDS       T00778                                 

Gene name
mtlA
Definition
(GenBank) PTS system, mannitol-specific IIABC component
  KO
K02798  PTS system, mannitol-specific IIA component [EC:2.7.1.197]
K02799  PTS system, mannitol-specific IIB component [EC:2.7.1.197]
K02800  PTS system, mannitol-specific IIC component
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00051  Fructose and mannose metabolism
ecf02060  Phosphotransferase system (PTS)
Module
ecf_M00274  PTS system, mannitol-specific II component
Brite
KEGG Orthology (KO) [BR:ecf00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ECH74115_4969 (mtlA)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    ECH74115_4969 (mtlA)
Enzymes [BR:ecf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.197  protein-Npi-phosphohistidine---D-mannitol phosphotransferase
     ECH74115_4969 (mtlA)
Transporters [BR:ecf02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Mannitol-specific II component [MD:M00274]
    ECH74115_4969 (mtlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_2 PTS_EIIC PTS_IIB
Motif
Other DBs
NCBI-ProteinID: ACI35632
Structure
PDB: 

Position
4616332..4618245
Genome map
AA seq 637 aa AA seqDB search
MSSDIKIKVQSFGRFLSNMVMPNIGAFIAWGIITALFIPTGWLPNETLAKLVGPMITYLL
PLLIGYTGGKLVGGERGGVVGAITTMGVIVGADMPMFLGSMIAGPLGGWCIKHFDRWVDG
KIKSGFEMLVNNFSAGIIGMILAILAFLGIGPIVETLSKMLAAGVNFMVVHDMLPLASIF
VEPAKILFLNNAINHGIFSPLGIQQSHELGKSIFFLIEANPGPGMGVLLAYMFFGRGSAK
QSAGGAAIIHFLGGIHEIYFPYVLMNPRLILAVILGGMTGVFTLTILGGGLVSPASPGSI
LAVLAMTPKGAYFANIAGVCAAMAVSFVVSAILLKTSKVKEEDDIEAATRRMQDMKAESK
GASPLSAGDVTNDLSHVRKIIVACDAGMGSSAMGAGVLRKKIQDAGLSQISVTNSAINNL
PPDVDLVITHRDLTERAMRQVPQAQHISLTNFLDSGLYTSLTERLVAAQRHTENEVKVKD
SLKDSFDDSSANLFKLGAENIFLGRKAATKEEAIRFAGEQLVKGGYVEPEYVQAMLDREK
LTPTYLGESIAVPHGTVEAKDRVLKTGVVFCQYPEGVRFGEEEDDIARLVIGIAARNNEH
IQVITSLTNALDDESVIERLAHTTSVDEVLELLAGRK
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccgatattaagatcaaagtgcaaagctttggtcgtttcctcagcaacatggtg
atgccaaatatcggcgcgtttatcgcgtggggtatcatcaccgcgttatttattccaaca
gggtggttaccgaacgagacgctggcgaagctggtcgggccgatgatcacttatctcctg
ccgctgctgatcggttataccggtggtaagctggtaggcggcgaacgtggcggcgtagtc
ggtgccatcaccaccatgggcgttatcgtcggcgcagacatgccgatgttcctcggttct
atgattgcaggtccgctgggcggctggtgcattaagcacttcgaccgctgggtagacggt
aagatcaaatccggttttgagatgctggtgaataacttctccgcaggcatcatcgggatg
atcctcgctattctggcattcctcggcattggcccgattgttgaaaccctgtccaaaatg
ctggctgcgggcgttaacttcatggttgtccatgacatgctgccgctggcgtctatcttt
gttgaaccggcgaaaatcctgttcctcaacaacgccattaaccacggtatcttctcgccg
ctgggtattcagcagtcccatgaactgggtaaatcaatcttcttcctgattgaagctaac
ccaggtccaggtatgggcgtgctgctggcgtacatgttctttggtcgtggtagcgctaaa
cagtctgcgggcggtgcggcaatcatccacttcctgggtggtatccacgaaatctacttc
ccgtatgtgctgatgaatccgcgtctgatcctcgcagtcatcctcggcggtatgactggc
gtgttcacgctgactatcctgggcggtggtctggtttctccggcatctccgggttctatc
cttgctgtactggcgatgacaccaaaaggtgcttatttcgctaacatcgcgggtgtgtgt
gcggcgatggctgtctccttcgttgtctctgctattttgctgaaaaccagcaaagtgaaa
gaagaagatgatattgaagcagcaactcgtcgtatgcaggacatgaaagctgagtctaaa
ggtgcatctccgctgtctgcgggcgatgtgactaacgacctgagccacgtacgtaaaatc
atcgttgcctgtgacgccggtatgggttccagtgcgatgggcgcaggcgtgctgcgtaag
aaaattcaggatgcaggtctgtcacagatttcggtcactaacagcgcgatcaacaacctg
ccgccagatgtggacctcgtcatcactcaccgtgacctgaccgaacgcgctatgcgccag
gttcctcaggcacagcatatttcgctaaccaacttcctcgacagcggcctgtacaccagc
ctgactgaacgtctggttgctgcccagcgacatactgaaaacgaagtgaaagtgaaagac
agtctgaaagacagctttgacgattccagtgctaacctgttcaaactgggcgcggagaac
atcttcctcggtcgcaaagcagcaaccaaagaagaagcgattcgttttgctggcgagcag
ctggtgaaaggcggttacgttgagccggagtacgttcaggcgatgctggatcgtgaaaaa
ctgaccccgacttatctgggtgagtctatcgcggtgccacacggtacggttgaagcgaaa
gatcgcgtactgaaaacgggcgtggtgttctgccagtacccggaaggcgtgcgcttcggt
gaagaagaagatgacattgctcgtctggtgattggtattgctgcccgtaacaacgagcac
attcaggttatcaccagcctgaccaacgcactggatgatgagtccgtcatcgagcgtctg
gcacacaccaccagcgtggatgaagtgctggaactgctggcaggtcgtaagtaa

DBGET integrated database retrieval system