KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4972Help
Entry
ECH74115_4972     CDS       T00778                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_theta
Motif
Other DBs
NCBI-ProteinID: ACI38807
Position
complement(4620087..4620296)
Genome map
AA seq 69 aa AA seqDB search
MGKLGENVPLLIDKAVDFMASSQAFREYLKKLPPRNAIPSGIPDESVPLYLQRLEYYRRL
YRPKQVEGQ
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaattaggtgaaaacgttccgcttcttatcgataaagccgtagatttcatggca
tcaagccaggcgttccgggagtatctgaaaaaacttcctccccgtaacgcgattccgtcc
ggaatacccgatgaaagcgtgccgttatatctacaacgtctggagtattatcgtcggctt
tatcggccgaagcaggtagaggggcagtaa

DBGET integrated database retrieval system