KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4975Help
Entry
ECH74115_4975     CDS       T00778                                 

Definition
(GenBank) Hep_Hag family protein
  KO
K21449  trimeric autotransporter adhesin
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecf02000]
    ECH74115_4975
Transporters [BR:ecf02000]
 Other Transporters
  Pores ion channels [TC:1]
   ECH74115_4975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YadA_stalk YadA_head YadA_anchor ESPR
Motif
Other DBs
NCBI-ProteinID: ACI36522
Position
4622213..4626979
Genome map
AA seq 1588 aa AA seqDB search
MNKIFKVIWNPATGNYTVTSETAKSRGKKSGRSKLLISALVAGGMLSSFGALANAGNDNG
QGVDYGSGSAGDGWVAIGKGAKANTFMNTSGSSTAVGYDAIAEGQYSSAIGSKTHAIGGA
SMAFGVSAISEGDRSIALGASSYSLGQYSMALGRYSKALGKLSIAMGDSSKAEGANAIAL
GNATKATEIMSIALGDTANASKAYSMALGASSVASEENAIAIGAETEAAENATAIGNNAK
AKGTNSMAMGFGSLADKVNTIALGNGSQALADNAIAIGQGNKADGVDAIALGNGSQSRGL
NTIALGTASNATGDKSLALGSNSSANGINSVALGADSIADLDNTVSVGNSSLKRKIVNVK
NGAIKSDSYDAINGSQLYAISDSVAKRLGGGAAVDVDDGTVTAPTYNLKNGSKNNVGAAL
AVLDENTLQWDQTKGKYSAAHGTSSPTASVITDVADGTISASSKDAVNGSQLKATNDDVE
ANTANIATNTSNIATNTANIATNTTNITNLTDSVGDLQADALLWNETKKAFSAAHGQDTT
SKITNVKDADLTADSTDAVNGSQLKTTNDAVATNTTNIANNTSNIATNTTNISNLTETVT
NLGEDALKWDKDNGVFTAAHGTETTSKITNVKDGDLTTGSTDAVNGSQLKTTNDAVATNT
TNIATNTTNISNLTETVTNLGEDALKWDKDNGVFTAAHGNNTASKITNILDGTVTATSSD
AINGSQLYDLSSNIATYFGGNASVNTDGVFTGPTYKIGETNYYNVGDALAAINSSFSTSL
GDALLWDATAGKFSAKHGTNGDASVITDVADGEISDSSSDAVNGSQLHGVSSYVVDALGG
GAEVNADGTITAPTYTIANADYDNVGDALNAIDTTLDDALLWDADAGENGAFSAAHGKDK
TASVITNVANGAISAASSDAINGSQLYTTNKYIADALGGDAEVNADGTITAPTYTIANAE
YNNVGDALDALDDNALLWDETANGGAGAYNASHDGKASIITNVANGSISEDSTDAVNGSQ
LNATNMMIEQNTQIINQLAGNTDATYIQENGAGINYVRTNDDGLAFNDASAQGVGATAIG
YNSVAKGDSSVAIGQGSYSDVDTGIALGSSSVSSRVIAKGSRDTSITENGVVIGYDTTDG
ELLGALSIGDDGKYRQIINVADGSEAHDAVTVRQLQNAIGAVATTPTKYFHANSTEEDSL
AVGTDSLAMGAKTIVNGDKGIGIGYGAYVDANALNGIAIGSNAQVIHVNSIAIGNGSTTT
RGAQTNYTAYNMDAPQNSVGEFSVGSADGQRQITNVAAGSADTDAVNVGQLKVTDAQVSQ
NTQSITNLDNRVTNLDSRVTNIENGIGDIVTTGSTKYFKTNTDGVDASAQGKDSVAIGSG
SIAAADNSVALGTGSVATEENTISVGSSTNQRRITNVAAGKNATDAVNVAQLKSSEAGGV
RYDTKADGSIDYSNITLGGGNGGTTRISNVSAGVNNNDVVNYAQLKQSVQETKQYTDQRM
VEMDNKLSKTESKLSGGIASAMAMTGLPQAYTPGASMASIGGGTYNGESAVALGVSMVSA
NGRWVYKLQGSTNSQGEYSAALGAGIQW
NT seq 4767 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaatatttaaagttatctggaaccctgcgacagggaattatactgttaccagc
gaaacggcaaaaagccgtggcaagaaatctgggcgcagtaagctgttaatttctgcgctg
gttgcgggtggaatgttgtcgtcgtttggggcattggcgaatgccgggaatgacaacggt
cagggtgttgattacggtagtggatcagctggcgacggctgggttgctataggcaaaggg
gcgaaagcaaatacttttatgaacaccagtggttccagtactgctgtgggttatgacgct
atagctgaaggccaatatagctctgccatcgggtcaaaaacccatgcgattggtggtgca
tcaatggcctttggggttagtgcaatatcagaaggcgatagaagtatagcactgggtgcc
tcttcgtattcattgggccaatactcaatggccctcggccgttattcaaaagcattgggt
aaattgtctattgctatgggggactcttccaaagcggaaggagcaaacgccattgccctg
ggaaatgccactaaagctactgagattatgagtattgctcttggcgacaccgccaatgcg
tcaaaagcgtattcaatggcgctgggagcaagtagcgtcgcatctgaagaaaacgctatt
gcgataggtgctgagaccgaagccgctgaaaatgcaactgctattggcaataatgcgaag
gcaaaagggactaatagcatggcaatggggttcggaagccttgccgataaagtcaatact
atcgcattaggaaatggcagccaggctctggcagataatgcaatcgccataggccagggc
aacaaagctgatggcgtggatgccatcgctctgggtaatggtagccagtcgagaggctta
aacaccattgccttaggcacagccagtaatgcaactggtgataagagtcttgcgcttggt
agtaatagcagtgccaacggtattaactctgtcgcgctgggcgcagattccattgcggat
ttagacaataccgtctctgtcggcaatagttcattaaaacgcaagatcgttaatgtgaaa
aatggcgcgatcaagtctgacagttacgatgccattaatggttcacagctttatgccatt
agcgactcggtagcaaaaaggcttggaggaggggctgcagtagatgttgatgacggtact
gttacagcaccaacctacaatttaaaaaatggtagcaaaaataacgtaggggctgcgctc
gctgtacttgatgaaaacaccctgcaatgggaccaaaccaaaggcaaatacagcgctgct
catggtactagtagcccaactgccagcgtaatcaccgatgttgcggatggcacgatttca
gcctccagtaaggatgcggttaacggttcccaactgaaagctaccaatgacgatgtcgaa
gccaacaccgccaatatcgctactaataccagcaacattgccacgaatacggcaaatatt
gccaccaataccaccaatatcaccaacctgacggattccgttggtgaccttcaggctgat
gccctgctctggaacgaaactaaaaaggcattcagtgcagctcacggccaggataccacc
agcaaaatcaccaacgttaaagatgccgacctgacggctgacagcactgatgctgttaac
ggctctcagctgaaaaccaccaacgatgctgtggcgacgaataccaccaatatcgccaat
aacacttccaatattgccactaacaccaccaacatctctaacctgactgagacggtgact
aatcttggtgaggatgcgctgaaatgggataaggacaatggtgtattcacggcagctcat
ggcaccgagaccaccagcaaaatcaccaacgttaaagatggcgacctgacgactggcagc
accgatgccgttaacggctctcagctgaaaaccaccaacgatgccgtggcgacgaatacc
accaatatcgccactaacaccaccaacatctctaatctgactgagacggtgactaatctt
ggtgaggatgcgctgaaatgggataaggacaatggtgtcttcactgcagctcatggcaac
aataccgccagcaaaatcaccaatatcctggacggcacagtcactgcaaccagttccgat
gccattaacggtagccagctttatgacttaagcagcaatatcgccacctacttcggcggc
aatgcttctgtgaatactgacggtgtgtttaccggtccaacctacaaaatcggtgaaaca
aattattataacgtcggcgatgcactggctgcgattaactcctcatttagcacgtctctc
ggcgatgctctgctttgggatgccaccgcaggtaaattcagtgccaaacacggtactaat
ggtgacgcaagcgtgatcactgatgtcgcagatggtgaaatttcagactccagttctgac
gcagtaaacggctcacaactccacggcgtgagcagttatgttgttgatgcgctggggggt
ggtgccgaagtcaatgcagacggcaccatcactgcgccgacgtacaccattgctaatgct
gattacgataatgtcggtgatgccctgaatgctatcgataccactcttgacgacgctctg
ctctgggatgcggacgccggtgaaaatggtgcatttagcgccgctcacggaaaagataaa
actgccagtgtaatcactaacgtcgctaacggtgcaatctctgctgccagcagcgacgcg
attaacggctcacaactctataccaccaataagtacatcgctgatgcgctgggtggtgac
gcagaagtcaacgctgacggcaccatcaccgcaccgacttacaccattgcgaacgccgag
tacaacaacgtcggtgacgccctggatgcgcttgatgataacgccctgctgtgggatgag
actgccaatggcggtgctggagcctacaatgccagccatgacggtaaagccagcatcatc
actaatgtcgctaatggcagtattagtgaggacagtaccgatgcagtgaacggttctcag
ttgaatgcgacgaatatgatgattgagcagaacacccaaattatcaatcagctcgctggt
aacaccgacgcaacctatatccaagaaaacggtgcgggtattaactatgtgcgtactaac
gacgacggcttagcgttcaacgacgccagcgcacagggtgttggcgctacagctataggt
tataactctgtcgccaaaggcgatagcagcgtagctattggtcagggcagctacagcgac
gttgatacgggtatcgccctgggtagcagctctgtttccagccgagtgattgccaaaggc
tcccgtgacaccagcataacggaaaatggcgttgttattggttacgacaccacggatggc
gaactgctcggtgcattgtctatcggtgatgacggtaaatatcgtcaaatcatcaacgta
gccgatggttccgaagcccatgacgccgttacggttcgtcaattgcagaatgcgattggt
gcggtcgcaaccacgccgactaaatacttccacgctaattcaacggaagaagattcactg
gcagtgggaactgactcgctggcaatgggtgcgaaaaccatcgtgaatggcgataaaggt
attggtatcggttatggtgcctacgtggacgcgaatgcacttaacggcattgccattggt
agcaatgcgcaagtcattcatgtcaacagtattgcgataggtaatggttctacgaccact
cgtggcgctcaaaccaattataccgcctacaacatggacgcaccgcagaactctgtcggt
gaattctcagtcggtagtgcggatggtcaacgtcagatcactaacgtcgcagcaggttcg
gctgataccgatgcggtcaacgtgggtcagttgaaagtaacggatgcgcaggtttcccag
aatacccagagcattactaacctggataatcgggtaacgaatcttgattcacgcgtcacc
aatatcgaaaacggtattggcgatatcgtcaccaccggtagcaccaagtacttcaagacc
aataccgatggtgtagatgccagcgcgcagggtaaagatagcgtcgcgattggttccggc
tccattgctgccgctgacaacagcgtcgctctgggtacagggtctgtggcaaccgaagaa
aatacgatctctgtaggttcctctactaaccaacgtcgtatcaccaacgtagctgcaggt
aaaaatgctaccgatgctgttaacgtggcacagttgaagtcttccgaagctggcggtgta
cgttacgacaccaaagctgatggttctatcgactatagcaatatcaccctcggtggcggc
aacggcggtacgactcgtatcagcaacgtctccgctggcgtcaacaacaacgacgtggtg
aattacgcgcagttgaagcaaagcgtgcaggaaacgaagcaatacaccgatcagcgaatg
gttgagatggataacaaactgtctaaaactgaaagcaagttgagcggtggtatcgcttct
gcaatggcaatgaccggtctgccgcaggcttacactccaggtgccagcatggcctctatt
ggtggcggtacttacaacggtgaatcggcagttgctttaggtgtatcgatggtgagcgcc
aatggtcgttgggtctacaaattacaaggtagtaccaatagccagggtgaatactccgcc
gcactcggtgccggtattcagtggtaa

DBGET integrated database retrieval system