KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4978Help
Entry
ECH74115_4978     CDS       T00778                                 

Gene name
lldD
Definition
(GenBank) L-lactate dehydrogenase
  KO
K00101  L-lactate dehydrogenase (cytochrome) [EC:1.1.2.3]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00620  Pyruvate metabolism
ecf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECH74115_4978 (lldD)
Enzymes [BR:ecf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.2  With a cytochrome as acceptor
    1.1.2.3  L-lactate dehydrogenase (cytochrome)
     ECH74115_4978 (lldD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_dh IMPDH NMO Glu_synthase IGPS ThiG His_biosynth DHO_dh
Motif
Other DBs
NCBI-ProteinID: ACI35364
UniProt: B5YWA7
Position
4629775..4630965
Genome map
AA seq 396 aa AA seqDB search
MIISAASDYRAAAQRILPPFLFHYMDGGAYSEYTLRRNVEDLSEVALRQRILKNMSDLSL
ETTLFNEKLSMPVALAPVGLCGMYARRGEVQAAKAADAHGIPFTLSTVSVCPIEEVAPAI
KRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMR
RYLQAVTHPQWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLGNNFDPSISWKDLEWI
RDFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD
IAILADSGIRNGLDVVRMIALGADTVLLGRAFLYALATAGQAGVANLLNLIEKEMKVAMT
LTGAKSISEITQDSLVQGLGKELPTALAPMAKGNAA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgattatttccgcagccagcgattatcgcgccgcagcgcaacgcattctgccgccgttc
ctgttccactatatggatggtggtgcatattctgaatacacgctgcgccgcaacgtggaa
gatttgtcagaagtggcactgcgccagcgtattctgaaaaacatgtctgacttaagcctg
gaaacgacgctgtttaatgagaaattgtcgatgccggtagcactggcaccggtgggtttg
tgtggcatgtatgcgcgtcgtggcgaagttcaggcagccaaagcggcggacgcgcatggc
attccgtttactctctcaacggtttccgtttgcccgattgaagaagtcgcgccagccatc
aagcgcccaatgtggttccagctttatgtactgcgcgatcgcggctttatgcgtaacgcg
ctggagcgagcaaaagcagcgggttgttcgacgctggttttcaccgtggatatgccgaca
ccgggagcgcgttatcgtgatgcgcattctgggatgagcggcccaaatgcggcaatgcgc
cgctacttgcaagcggtgacgcatccgcaatgggcgtgggatgtgggcctgaacggtcgt
ccgcatgatttaggtaatatttcggcttacctcggcaaaccgaccggactggaagattac
atcggctggctggggaataacttcgatccgtccatctcatggaaagaccttgagtggatc
cgcgatttctgggatggcccgatggtgatcaaagggatcctcgatccggaagatgcgcgc
gatgcagtacgttttggtgctgatgggattgtagtttctaaccacggtggccgccagctg
gacggtgtactctcttccgctcgtgcgttgcccgctattgcagatgcggtgaaaggtgat
atcgccattctggcggatagcggaattcgtaacgggcttgatgtcgtgcgtatgattgcg
ctcggtgccgacaccgtactgctgggtcgtgctttcctgtatgcgctggcaacagcgggc
caggcgggtgtagctaacctgctaaatctgatcgagaaagagatgaaagtggcaatgacg
ctgactggcgcgaaatcgatcagtgaaattacgcaagattcgctggtgcaggggctgggt
aaagagttgcctacggcactggctccgatggcgaaagggaatgcggcatag

DBGET integrated database retrieval system