KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4981Help
Entry
ECH74115_4981     CDS       T00778                                 

Definition
(GenBank) NAD-dependent glycerol-3-phosphate dehydrogenase
  KO
K00057  glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC:1.1.1.94]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00564  Glycerophospholipid metabolism
ecf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECH74115_4981
Enzymes [BR:ecf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.94  glycerol-3-phosphate dehydrogenase [NAD(P)+]
     ECH74115_4981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_Gly3P_dh_C NAD_Gly3P_dh_N ApbA F420_oxidored NAD_binding_2 UDPG_MGDP_dh_N GIDA 3HCDH_N Rossmann-like NAD_binding_8 TrkA_N Pyr_redox_2 IlvN Methyltransf_23 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: ACI37131
UniProt: B5YWB0
Position
complement(4632578..4633597)
Genome map
AA seq 339 aa AA seqDB search
MNQRNASMTVIGAGSYGTALAITLARNGHEVVLWGHDPEHIATLERDRCNAAFLPDVPFP
DTLHLESDLATALAASRNILVVVPSHVFGEVLRQIKPLMRPDARLVWATKGLEAETGRLL
QDVAREALGDQIPLAVISGPTFAKELAAGLPTAISLASTDQTFADDLQQLLHCGKSFRVY
SNPDFIGVQLGGAVKNVIAIGAGMSDGIGFGANARTALITRGLAEMSRLGAALGADPATF
MGMAGLGDLVLTCTDNQSRNRRFGMMLGQGMDVQSAQEKIGQVVEGYRNTKEVRELAHRF
GVEMPITEEIYQVLYCGKNAREAALTLLGRARKDERSSH
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaacgtaatgcttcaatgactgtgatcggtgccggctcgtacggcaccgctctt
gccatcaccctggcaagaaatggccacgaggttgtcctctggggccatgaccctgaacat
atcgcaacgcttgaacgcgaccgctgtaacgccgcgtttctccccgatgtgccttttccc
gatacgctccatcttgaaagcgatctcgccactgcgctggcagccagccgtaatattctc
gtcgtcgtacccagccatgtctttggtgaagtgctgcgccagattaaaccgctgatgcgt
cctgatgcgcgtctggtgtgggcgaccaaagggctggaagcggaaaccggacgtctgtta
caggacgtggcgcgtgaggccttaggcgatcaaattccgctggcggttatctctggccca
acgtttgcgaaagaactggcggcaggtttaccgacagctatttcgctggcctcgaccgat
cagacctttgccgatgatctccagcagctgctgcactgcggcaaaagtttccgcgtttac
agcaatccggatttcattggcgtgcagcttggcggtgcggtgaaaaacgtcattgccatt
ggcgcggggatgtccgacggtatcggttttggtgcgaatgcgcgtacggcactgatcacc
cgtgggctggctgaaatgtcgcgtcttggcgcggcgctgggtgccgatcctgccaccttt
atgggcatggcggggctgggcgatcttgtgcttacttgtaccgacaaccagtcgcgtaac
cgccgttttggcatgatgctcggtcagggcatggatgtacaaagcgcgcaggagaagatt
ggtcaggtggtggaaggctaccgcaatacgaaagaagtccgcgaactggcgcatcgcttc
ggcgtagaaatgccaataaccgaggaaatttatcaagtattatattgcggaaaaaacgcg
cgcgaggcagcattgacgttattaggtcgtgcacgcaaggacgagcgcagcagccactaa

DBGET integrated database retrieval system