KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4983Help
Entry
ECH74115_4983     CDS       T00778                                 

Gene name
grxC
Definition
(GenBank) glutaredoxin 3
  KO
K03676  glutaredoxin 3
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Brite
Chaperones and folding catalysts [BR:ecf03110]
 Protein folding catalysts
  Protein disulfide isomerase
   ECH74115_4983 (grxC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaredoxin GST_N_3 GST_N_2 DUF836 SH3BGR Thioredoxin_3 GST_N Thioredoxin_2
Motif
Other DBs
NCBI-ProteinID: ACI35649
Structure
PDB: 

Position
complement(4634127..4634378)
Genome map
AA seq 83 aa AA seqDB search
MANVEIYTKETCPYCHRAKALLSSKGVSFQELPIDGNAAKREEMIKRSGRTTVPQIFIDA
QHIGGCDDLYALDARGGLDPLLK
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgttgaaatctataccaaagaaacctgcccgtattgccatcgtgcaaaagca
ctgctgagcagcaagggcgtgagttttcaggagttgccgatcgatggcaatgccgccaag
cgtgaagagatgatcaaacgcagcggtcgcaccacggttccccagatttttattgacgca
cagcacattggcggctgtgatgacttgtatgcattggatgcacgtggtggactggatccc
ctgctgaaataa

DBGET integrated database retrieval system