KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4984Help
Entry
ECH74115_4984     CDS       T00778                                 

Definition
(GenBank) rhodanese domain protein
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese Baculo_Y142 MNHE
Motif
Other DBs
NCBI-ProteinID: ACI37361
Position
complement(4634520..4634951)
Genome map
AA seq 143 aa AA seqDB search
MQEIMQFVGRHPILSIAWIALLVAVLVTTFKSLTSKVKVITRGEATRLINKEDAVVVDLR
QRDDFRKGHIAGSINLLPSEIKANNVGELEKHKDKPVIVVDGSGMQCQEPANALTKAGFA
QVFVLKEGVAGWAGENLPLVRGK
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaattatgcaatttgttggccgtcatcccatactgagtatcgcctggatcgcg
ttactggtggcggttcttgtgactacgtttaagagcctgacctcgaaagtgaaggtgatt
actcgtggtgaagctacgcgtctgatcaacaaagaagacgctgtggttgtggatttacgt
cagcgtgatgacttccgtaaaggccatatcgcaggttctatcaatctgttgccgagcgaa
atcaaagccaacaatgttggtgagcttgagaagcacaaagacaaaccggttatcgtggta
gacggttctggcatgcagtgccaggagcctgcaaacgcactgacgaaagctggttttgcg
caagtattcgtgctgaaagaaggcgtcgctggctgggctggcgaaaacttgcctttggtg
cgcggcaaataa

DBGET integrated database retrieval system