KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4989Help
Entry
ECH74115_4989     CDS       T00778                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00260  Glycine, serine and threonine metabolism
Brite
KEGG Orthology (KO) [BR:ecf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECH74115_4989 (tdh)
Enzymes [BR:ecf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     ECH74115_4989 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C HI0933_like FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_3 Pyr_redox_2 Methyltransf_25 Methyltransf_16 MTS Pyr_redox UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ACI38839
UniProt: B5YWB7
Position
complement(4640257..4641282)
Genome map
AA seq 341 aa AA seqDB search
MKALSKLKAEEGIWMTDVPVPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKTIPVPMV
VGHEYVGEVVGIGQEVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGC
FAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDLVGEDVLVSGAGPIGIMAA
AVAKHVGARNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELGMTEGFDVGLEMS
GAPPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWTKVIFKGLFIKGIYGREMFETWYKMAA
LIQSGLDLSPIITHRFSIDDFQKGFDAMCSGQSGKVILSWD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttatccaaactgaaagcggaagagggcatctggatgaccgacgttcctgta
ccggaactcgggcataacgatctgctgattaaaatccgtaaaacagccatctgcgggact
gacgttcacatctataactgggatgagtggtcgcaaaaaaccatcccggtgccgatggtc
gtaggccatgaatatgtcggtgaagtggtaggtattggtcaggaagtgaaaggcttcaaa
atcggcgatcgcgtttctggcgaaggccatatcacctgcggtcactgtcgcaactgtcgt
ggcggtcgtacccatctgtgccgcaacaccattggtgtcggtgttaaccgtccgggctgc
ttcgccgaatatctggtgattccggcgttcaacgctttcaaaatccccgacaatatctcc
gacgacctggcttccatttttgatcccttcggtaacgccgtgcataccgcgctgtcgttc
gatctggtgggcgaagatgtgctggtttctggtgcaggtccgataggtattatggctgcg
gcggtggcgaaacacgttggtgcacgcaatgtggtgatcaccgatgttaacgaataccgc
cttgagctggcgcgcaaaatgggtatcacccgtgcggttaacgtcgcgaaagaaaacctt
aatgatgtgatggctgaactgggcatgaccgaaggctttgatgtcggtctggaaatgtcc
ggcgcgccgccagcgtttcgtaccatgctcgataccatgaaccacggcggtcgtattgcg
atgctgggtattccaccgtctgacatgtctatcgactggaccaaagtgatctttaaaggc
ttgttcattaaaggcatttacggtcgtgagatgtttgaaacctggtacaagatggcggcg
ctgattcagtctggcctcgatctctcgccgatcattacccatcgtttctctatcgatgat
ttccagaagggctttgacgctatgtgttcgggccagtccgggaaagttattctgagctgg
gattaa

DBGET integrated database retrieval system