KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_5002Help
Entry
ECH74115_5002     CDS       T00778                                 

Gene name
rfaQ
Definition
(GenBank) lipopolysaccharide core biosynthesis glycosyltransferase RfaQ
  KO
K02849  heptosyltransferase III [EC:2.4.-.-]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00540  Lipopolysaccharide biosynthesis
ecf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    ECH74115_5002 (rfaQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ecf01003]
    ECH74115_5002 (rfaQ)
   01005 Lipopolysaccharide biosynthesis proteins [BR:ecf01005]
    ECH74115_5002 (rfaQ)
Enzymes [BR:ecf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     ECH74115_5002 (rfaQ)
Glycosyltransferases [BR:ecf01003]
 Polysaccharide
  Bacterial polysaccharide
   ECH74115_5002 (rfaQ)
Lipopolysaccharide biosynthesis proteins [BR:ecf01005]
 Core region
  ECH74115_5002 (rfaQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_9 Glyco_trans_4_2 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: ACI35193
Position
complement(4654032..4655090)
Genome map
AA seq 352 aa AA seqDB search
MDKPFRRILLIKMRFHGDMLLTTPVISSLKKNYPDAKIDVLLYQDTIPILSENPEINALY
GIKNKKAKASEKIANFFHLIKVLRANKYDLIVNLTDQWMVAILVRLLNARVKISQDYHHR
QSAFWRKSFTHLVPLQGGNVVESNLSVLTPLGLDSLVKQTTMSYPPASWKRMRRELDHAG
VGQNYVVIQPTARQIFKCWDNAKFSAVIDALHARGYEVVLTSGPDKDDLACVNEIAQGCQ
TPPVTALAGKVTFPELGALIDHAQLFIGVDSAPAHIAAAVNTPLISLFGATDHIFWRPWS
NNMIQFWAGDYREMPTRDQRDRNEMYLSVIPAADVIAAVDKLLPSSTTGTSL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtggataagccatttcgaagaattttgctcattaagatgcgttttcatggggatatgtta
ttaactactcccgtcattagttcgctgaaaaaaaattaccctgacgcaaaaatcgatgtg
ctgctttatcaggacaccatcccgatcctgtctgaaaatccagagattaacgcgctctac
ggcataaaaaataaaaaagcaaaagcctcagaaaaaattgccaacttttttcatctcatc
aaggtattacgtgccaataagtatgaccttatcgtcaatcttaccgatcaatggatggtt
gctatactggttcgcttattaaatgcccgtgtgaaaatttcccaggattatcatcatcgg
cagtctgctttttggcgtaaaagtttcacccatttggtgccgttgcagggtggaaatgtg
gtggaaagtaacttatccgtgctgacaccattgggacttgattcgttggtgaagcagaca
accatgagttacccgcctgcaagctggaaacgtatgcgtcgcgaacttgatcacgctggt
gttggacaaaattatgtggttatccaacctacggcgcggcaaatcttcaaatgctgggac
aacgccaagttttccgctgtgattgatgccttacatgctcgtggttatgaagtcgttctg
acgtccggcccagataaagacgatctggcctgcgtcaatgaaattgcgcaaggatgccag
acgccaccagtaacggcgctggctggaaaggtgaccttcccggaacttggtgcgttaatc
gatcatgcgcagctgtttattggcgttgattccgcaccggcgcatattgccgctgcagtt
aatacgccgctgatatcgctgtttggtgcgacagaccatattttctggcgtccttggtca
aataacatgattcaattctgggcgggagattaccgggaaatgccaacgcgcgatcagcgt
gaccgaaatgagatgtatctttcggttattccggcggcagatgtcattgctgctgtcgat
aaattactgccctcctccacgacaggtacgtcgttatga

DBGET integrated database retrieval system