KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_5003Help
Entry
ECH74115_5003     CDS       T00778                                 

Gene name
waaA
Definition
(GenBank) 3-deoxy-D-manno-octulosonic-acid transferase
  KO
K02527  3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00540  Lipopolysaccharide biosynthesis
ecf01100  Metabolic pathways
Module
ecf_M00060  Lipopolysaccharide biosynthesis, KDO2-lipid A
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    ECH74115_5003 (waaA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ecf01003]
    ECH74115_5003 (waaA)
   01005 Lipopolysaccharide biosynthesis proteins [BR:ecf01005]
    ECH74115_5003 (waaA)
Enzymes [BR:ecf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.12  lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     ECH74115_5003 (waaA)
    2.4.99.13  (Kdo)-lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     ECH74115_5003 (waaA)
    2.4.99.14  (Kdo)2-lipid IVA (2-8) 3-deoxy-D-manno-octulosonic acid transferase
     ECH74115_5003 (waaA)
    2.4.99.15  (Kdo)3-lipid IVA (2-4) 3-deoxy-D-manno-octulosonic acid transferase
     ECH74115_5003 (waaA)
Glycosyltransferases [BR:ecf01003]
 Polysaccharide
  Bacterial polysaccharide
   ECH74115_5003 (waaA)
Lipopolysaccharide biosynthesis proteins [BR:ecf01005]
 Core region
  ECH74115_5003 (waaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_N Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: ACI39530
Position
4655503..4656780
Genome map
AA seq 425 aa AA seqDB search
MLELLYTALLYLIQPLIWIRLWVRGRKAPAYRKRWGERYGFYRHPLKPGGIMLHSVSVGE
TLAAIPLVRALRHRYPDLPITVTTMTPTGSERVQSAFGKDVQHVYLPYDLPDALNRFLNK
VDPKLVLIMETELWPNLIAALHKRKIPLVIANARLSARSAAGYAKLGKFVRRLLRRITLI
AAQNEEDGARFVALGAKNNQVTVTGSLKFDISVTPQLAAKAVTLRRQWAPHRPVWIATST
HEGEESVVIAAHQALLQQFPNLLLILVPRHPERFPDAINLVRQAGLSYITRSSGEVPSTS
TQVVVGDTMGELMLLYGIADLAFVGGSLVERGGHNPLEAAAHAIPVLMGPHTFNFKDICA
RLEQASGLITVTDATTLAKEVSSLLTDADYRSFYGRHAVEVLYQNQGALQRLLQLLEPYL
PPKTH
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaattgctttacaccgcccttctctaccttattcagccgctgatctggatacgg
ctctgggtgcgcggacgtaaggctccggcctatcgaaaacgctggggtgaacgttacggt
ttttaccgccatccgctaaaaccaggcggcattatgctgcactccgtctccgtcggtgaa
actctggcggcgatcccgttggtgcgcgcgctgcgtcatcgttatcctgatttacctatt
accgtaacaaccatgacgccaaccggttcggagcgcgtacaatcggctttcgggaaggat
gttcagcacgtttatctgccgtatgatctgcccgatgcactcaaccgtttcctgaataaa
gtcgaccctaaactggtgttgattatggaaaccgaactatggcctaacctgattgcggcg
ctacataaacgtaaaattccgctggtgatcgctaacgcgcgactctctgcccgctcggcc
gcaggttatgccaaactgggtaaattcgtccgtcgcttgctgcgtcgtattacgctgatt
gccgcccaaaatgaagaagatggtgcacgttttgtggcgctgggcgcgaaaaataaccag
gtaaccgttaccggtagcctgaaattcgatatttctgtaacgccgcagttggctgctaaa
gccgtgacgctgcgccgccagtgggcaccacaccgcccggtatggattgccaccagcact
cacgaaggtgaagagagcgtggtcattgccgcacatcaggctttattacagcaattcccg
aatttattgctcatcctggtaccccgtcatccagaacgcttcccggatgcgattaacctt
gtccgccaggctggactaagctatatcacacgctcttcaggggaagtcccctccaccagc
acgcaggttgtggttggcgatacgatgggcgagttgatgttactgtacggcattgccgat
ctcgcctttgttggcggttcactggttgaacgtggtgggcataatccgctggaagctgcc
gcacacgcaattccggtattgatggggccgcatacttttaactttaaagacatttgcgcg
cggctggagcaggcaagcgggctgattaccgttaccgatgccactacgcttgcaaaagag
gtttcctctttactcaccgacgccgattaccgtagtttctatggccgtcatgccgttgaa
gtactgtatcaaaaccagggcgcgctacagcgtctgcttcaactgctggaaccttacctg
ccaccgaaaacgcattga

DBGET integrated database retrieval system