KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_5009Help
Entry
ECH74115_5009     CDS       T00778                                 

Gene name
coaBC
Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00770  Pantothenate and CoA biosynthesis
ecf01100  Metabolic pathways
Module
ecf_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ECH74115_5009 (coaBC)
Enzymes [BR:ecf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     ECH74115_5009 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     ECH74115_5009 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein YjeF_N PALP
Motif
Other DBs
NCBI-ProteinID: ACI34665
Structure
PDB: 

Position
4659622..4660914
Genome map
AA seq 430 aa AA seqDB search
MKARQQKYCDKIANFWCHPTGKIIMSLAGKKIVLGVSGGIAAYKTPELVRRLRDRGADVR
VAMTEAAKAFITPLSLQAVSGYPVSDSLLDPAAEAAMGHIELGKWADLVILAPATADLIA
RVAAGMANDLVSTICLATPAPVAVLPAMNQQMYRAAATQHNLEVLASRGLLIWGPDSGSQ
ACGDIGPGRMLDPLTIVDMAVAHFSPVNDLKHLNIMITAGPTREPLDPVRYISNHSSGKM
GFAIAAAAARRGANVTLVSGPVSLPTPPFVKRVDVMTALEMEAAVNASVQQQNIFIGCAA
VADYRAATVAPEKIKKQATQGDELTIKMVKNPDIVAGVAALKDHRPYVVGFAAETNNVEE
YARQKRIRKNLDLICANDVSQPTQGFNSDNNALHLFWQDGDKVLPLERKELLGQLLLDEI
VTRYDEKNRR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggcacgacaacaaaagtattgtgataaaatcgccaacttctggtgtcacccaaca
ggaaaaatcatcatgagcctggccggtaaaaaaatcgttctcggcgttagcggcggtatt
gctgcctataaaacccctgaactggtgcgtcgtttgcgcgatcgcggggccgacgtccgc
gtagccatgaccgaagcggcaaaagcctttatcaccccacttagcttgcaggcggtttct
ggttatcccgtttccgacagtttgctggacccggcagccgaagccgctatgggccatatt
gagctgggtaaatgggctgatttagtgattctcgcccctgccacggcagatttgattgcc
cgtgttgctgccggaatggcgaatgacctggtatcgacgatttgtctggctacacctgcg
cctgtagccgtgctccccgccatgaaccagcagatgtaccgtgccgctgccacgcagcat
aatttagaggtgcttgcttcccgtggtttgctcatctgggggccagacagtggcagtcag
gcttgtggtgatatcggtcctgggcgaatgctcgatccgttaaccattgtggatatggcg
gtagcgcatttttcgcccgtcaacgacctgaaacatctgaacattatgattaccgccggc
ccgacgcgtgaaccgctcgatcccgtgcgttatatctctaatcacagctccggcaagatg
ggttttgctatcgccgccgccgctgcccgtcgtggcgcgaacgtcacgctggtatcaggt
ccggtttcactaccgacgccaccgtttgttaaacgtgttgatgtgatgaccgcgctggaa
atggaagccgccgtgaatgcttctgtacagcagcaaaatatttttatcggctgcgccgcc
gtggcggattatcgcgcagctaccgtggccccagagaaaatcaaaaagcaggccacgcag
ggtgatgaattaacaataaaaatggttaaaaaccccgatatcgtcgcaggcgttgccgca
ctaaaagaccatcgaccctacgtcgttggatttgccgccgaaacaaataatgtggaagaa
tacgcccggcaaaaacgtatccgtaaaaaccttgatctgatctgcgcgaacgatgtttcc
cagccaactcaaggatttaacagcgacaacaacgcattacaccttttctggcaggacgga
gataaagtcttaccgcttgagcgcaaagagctccttggccaattattactcgacgagatc
gtgacccgttatgatgaaaaaaatcgacgttaa

DBGET integrated database retrieval system