KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_5011Help
Entry
ECH74115_5011     CDS       T00778                                 

Definition
(GenBank) transcriptional regulator domain protein, TetR family
  KO
K05501  TetR/AcrR family transcriptional regulator
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecf03000]
    ECH74115_5011
   03036 Chromosome and associated proteins [BR:ecf03036]
    ECH74115_5011
Transcription factors [BR:ecf03000]
 Prokaryotic Type
  Helix-turn-helix
   TetR/AcrR family
    ECH74115_5011
Chromosome and associated proteins [BR:ecf03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Inhibitors of FtsZ assembly
    ECH74115_5011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N DUF390 MtrH
Motif
Other DBs
NCBI-ProteinID: ACI38750
UniProt: B5YWD9
Structure
PDB: 

Position
4661457..4662053
Genome map
AA seq 198 aa AA seqDB search
MAEKQTAKRNRREEILQSLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFD
SLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGERNPGLTRILTGHALMFEQDR
LQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLASQILAFCEGMLSRFVRSEFKY
RPTDDFDARWPLIAAQLQ
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaacaaactgcgaaaaggaaccgtcgcgaggaaatacttcagtctctggcg
ctgatgctggaatccagcgatggaagccaacgtatcacgacggcaaaactggccgcctct
gtcggcgtttccgaagcggcactgtatcgccacttccccagtaagacccgcatgttcgat
agcctgattgagtttatcgaagatagcctgattactcgcatcaatctgattctgaaagat
gagaaagacaccacagcgcgcctgcgtctgattgtgttgctgcttctcggttttggtgag
cgtaatcctggcctgacccgcatcctcactggtcatgcgctaatgtttgaacaggatcgc
ctgcaagggcgcatcaaccagctgttcgagcgtattgaagcgcagctgcgtcaggtattg
cgtgaaaagagaatgcgtgagggtgaaggttacaccaccgatgaaaccctgctggcaagc
cagatcctagccttctgtgaaggtatgctgtcacgttttgtccgcagcgaatttaaatac
cgcccgacggatgattttgacgcccgctggccgctaattgcggcacagttgcagtaa

DBGET integrated database retrieval system