KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_5019Help
Entry
ECH74115_5019     CDS       T00778                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gln-synt_C
Motif
Other DBs
NCBI-ProteinID: ACI35521
Position
complement(4667997..4668254)
Genome map
AA seq 85 aa AA seqDB search
MIYCNKDDSQEASSQTPFLPLGFAFTTLYICQPDYSGGEDESMDGDINKYLVLAIICVGG
LSGLVASQSTGRNFPPATANKTVGR
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
gtgatttactgcaataaagacgattctcaggaagcgtcctcgcagactccgtttttgcca
ctcggctttgccttcaccacgttgtatatctgccagcctgactacagcggaggtgaagat
gaaagtatggatggcgatattaataagtatcttgtgctggcaatcatctgtgtgggcggt
ctgtccggcctggtcgccagccagagcacaggaagaaattttccgcctgcaacagcaaat
aaaacagtgggacgatga

DBGET integrated database retrieval system