KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_5022Help
Entry
ECH74115_5022     CDS       T00778                                 

Gene name
spoT
Definition
(GenBank) guanosine-3',5'-bis(diphosphate) 3'-diphosphatase
  KO
K01139  GTP diphosphokinase / guanosine-3',5'-bis(diphosphate) 3'-diphosphatase [EC:2.7.6.5 3.1.7.2]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECH74115_5022 (spoT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ecf03009]
    ECH74115_5022 (spoT)
Enzymes [BR:ecf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     ECH74115_5022 (spoT)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.7  Diphosphoric-monoester hydrolases
    3.1.7.2  guanosine-3',5'-bis(diphosphate) 3'-diphosphatase
     ECH74115_5022 (spoT)
Ribosome biogenesis [BR:ecf03009]
 Prokaryotic Type
  Other maturation factors
   ECH74115_5022 (spoT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD_4 RelA_SpoT TGS ACT_4 HD TFIIS_M DUF2007 DUF106
Motif
Other DBs
NCBI-ProteinID: ACI39796
Position
4669366..4671474
Genome map
AA seq 702 aa AA seqDB search
MYLFESLNQLIQTYLPEDQIKRLRQAYLVARDAHEGQTRSSGEPYITHPVAVACILAEMK
LDYETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSKLDKLKFRDKKEAQAENFR
KMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETLEIYSPLAHRLGIHHIKT
ELEELGFEALYPNRYRVIKEVVKAARGNRKEMIQKILSEIEGRLQEAGIPCRVSGREKHL
YSIYCKMVLKEQRFHSIMDIYAFRVIVNDSDTCYRVLGQMHSLYKPRPGRVKDYIAIPKA
NGYQSLHTSMIGPHGVPVEVQIRTEDMDQMAEMGVAAHWAYKEHGETSTTAQIRAQRWMQ
SLLELQQSAGSSFEFIESVKSDLFPDEIYVFTPEGRIVELPAGATPVDFAYAVHTDIGHA
CVGARVDRQPYPLSQPLTSGQTVEIITAPGARPNAAWLNFVVSSKARAKIRQLLKNLKRD
DSVSLGRRLLNHALGGSRKLNEIPQENIQRELDRMKLATLDDLLAEIGLGNAMSVVVAKN
LQHGDASIPPATQSHGHLPIKGADGVLITFAKCCRPIPGDPIIAHVSPGKGLVIHHESCR
NIRGYQKEPEKFMAVEWDKETAQEFITEIKVEMFNHQGALANLTAAINTTTSNIQSLNTE
EKDGRVYSAFIRLTARDRVHLANIMRKIRVMPDVIKVTRNRN
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
ttgtatctgtttgaaagcctgaatcaactgattcaaacctacctgccggaagaccaaatc
aagcgtctgcggcaggcgtatctcgttgcacgtgatgctcacgaggggcaaacacgttca
agcggtgaaccctatatcacgcacccggtagcggttgcctgcattctggccgagatgaaa
ctcgactatgaaacgctgatggcggcgctgctgcatgacgtgattgaagatactcccgcc
acctaccaggatatggaacagctttttggtaaaagcgtcgccgagctggtagagggggtg
tcgaaacttgataaactcaagttccgcgataagaaagaggcgcaggccgaaaactttcgc
aagatgattatggcgatggtgcaggatatccgcgtcatcctcatcaaacttgccgaccgt
acccacaacatgcgcacgctgggctcacttcgcccggacaaacgtcgccgcatcgcccgt
gaaactctcgaaatttacagcccgctggcgcaccgtttaggtatccaccacattaaaacc
gaactcgaagagctgggttttgaggcgctgtatcccaaccgttatcgcgtaatcaaagaa
gtggtgaaagccgcgcgcggcaaccgtaaagagatgatccagaagattctttctgaaatc
gaagggcgtttgcaggaagcgggaataccgtgccgcgtcagtggtcgcgaaaagcatctt
tattcgatttactgtaaaatggtgctcaaagagcagcgttttcactcaatcatggacatc
tacgctttccgcgtgatcgtcaatgattctgacacctgttatcgcgtgctgggccagatg
cacagcctgtacaagccgcgtccgggccgcgtgaaagactatatcgccattccaaaagcg
aacggctatcagtcgttgcacacctcgatgattggcccgcacggcgtgccggttgaggtc
cagatccgtaccgaagatatggatcagatggcggagatgggtgttgccgcgcactgggct
tataaagagcacggcgaaaccagtactaccgcacaaatccgcgcccagcgctggatgcaa
agcctgctggagctgcaacagagcgccggtagttcgtttgaatttatcgagagcgttaaa
tccgatctcttcccggatgagatttacgttttcacaccggaagggcgcattgtcgagctg
cctgccggtgcaacgcccgtcgacttcgcttatgcagtgcataccgatatcggccatgcc
tgcgtgggcgcacgcgtcgaccgccagccttacccgctgtcgcagccgcttactagcggt
cagaccgttgaaatcattaccgctccgggcgctcgcccgaatgccgcttggctgaacttt
gtcgttagctcgaaagcgcgcgccaaaattcgtcagttgctgaaaaacctcaagcgtgat
gattctgtaagcctgggccgtcgtctgctcaaccatgctttgggtggtagccgtaagctc
aatgaaatcccgcaggaaaatattcagcgcgagctggatcgcatgaagctggcaacgctt
gacgatctgctggcagaaatcggccttggtaacgcaatgagcgtggtggtcgcgaaaaat
ctacaacatggggacgcctccattccaccggcgactcaaagccacgggcatctgccgatc
aaaggcgctgatggcgtgctgatcacctttgcgaaatgctgccgccccattcctggcgac
ccgattatcgcccacgtcagccccggtaaaggtctggtgatccaccatgaatcctgccgt
aacatccgtggctaccagaaagagccagagaagtttatggctgtggaatgggataaagag
acggcgcaggagttcatcaccgaaatcaaggtggagatgttcaatcatcagggtgcgctg
gcaaacctgacggcggcaattaacaccacgacctcgaatattcaaagtttgaatacggaa
gagaaagatggtcgcgtctacagcgcctttattcgtctgaccgctcgtgaccgtgtgcat
ctggcgaatatcatgcgcaaaatccgcgtgatgccagacgtgattaaagtcacccgaaac
cgaaattaa

DBGET integrated database retrieval system