KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_5023Help
Entry
ECH74115_5023     CDS       T00778                                 

Gene name
trmH
Definition
(GenBank) tRNA guanosine-2'-O-methyltransferase
  KO
K00556  tRNA (guanosine-2'-O-)-methyltransferase [EC:2.1.1.34]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ecf03016]
    ECH74115_5023 (trmH)
Enzymes [BR:ecf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.34  tRNA (guanosine18-2'-O)-methyltransferase
     ECH74115_5023 (trmH)
Transfer RNA biogenesis [BR:ecf03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    ECH74115_5023 (trmH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoU_methylase SpoU_methylas_C
Motif
Other DBs
NCBI-ProteinID: ACI37696
Position
4671481..4672170
Genome map
AA seq 229 aa AA seqDB search
MNPTRYARICEMLARRQPDLTVCMEQVHKPHNVSAIIRTADAVGVHEVHAVWPGSRMRTM
ASAAAGSNSWVQVKTHRTIGDAVAHLKGQGMQILATHLSDNAVDFREIDYTRPTCILMGQ
EKTGITQEALALADQDIIIPMIGMVQSLNVSVASALILYEAQRQRQNAGMYLRENSMLPE
AEQQRLLFEGGYPVLAKVAKRKGLPYPHVNQQGEIEADADWWATMQAAG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaacccaacacgttatgcacgcatctgcgaaatgctcgccaggcggcagcctgatctg
accgtctgcatggagcaggtccacaaacctcataacgtttctgcgattattcgtaccgca
gatgccgttggcgtacatgaagttcacgccgtctggcctggtagccgcatgcgcaccatg
gcttcggcagcggcgggtagtaacagctgggtacaggtgaaaacacaccgcaccattggc
gatgccgtcgctcatctcaaaggccagggcatgcagattctggcaacccatctttctgat
aacgctgtcgatttccgcgaaattgattacactcgcccgacctgcattttgatgggacag
gagaaaacgggcatcacgcaggaagcattggccctggcggatcaggacatcatcattccg
atgatcggcatggtgcagtcgctgaatgtttccgttgcctcagccctcattctttacgaa
gcccagcgtcagcggcaaaatgcaggcatgtacctgcgtgaaaacagcatgttgccggaa
gcagagcaacaacgcctgttgtttgaaggcggctatccggtgctggcgaaagtcgcaaaa
cgcaaaggcctgccttatccccacgtcaatcagcaaggcgagatcgaagctgatgccgac
tggtgggctactatgcaggctgcagggtaa

DBGET integrated database retrieval system