KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_5026Help
Entry
ECH74115_5026     CDS       T00778                                 

Gene name
gltS
Definition
(GenBank) sodium/glutamate symporter
  KO
K03312  glutamate:Na+ symporter, ESS family
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecf02000]
    ECH74115_5026 (gltS)
Transporters [BR:ecf02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ECH74115_5026 (gltS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glt_symporter
Motif
Other DBs
NCBI-ProteinID: ACI36827
Position
complement(4675111..4676316)
Genome map
AA seq 401 aa AA seqDB search
MFHLDTLATLVAATLTLLLGRKLVHSVSFLKKYTIPEPVAGGLLVALALLVLKKSMGWEV
NFDMSLRDPLMLAFFATIGLNANIASLRAGGRVVGIFLIVVVGLLVMQNAIGIGMASLLG
LDPLMGLLAGSITLSGGHGTGAAWSKLFIERYGFTNATEVAMACATFGLVLGGLIGGPVA
RYLVKHSTTPNGIPDDQEVPTAFEKPDVGRMITSLVLIETIALIAICLTVGKIVAQLLAG
TAFELPTFVCVLFVGVILSNGLSMMGFYRVFERAVSVLGNVSLSLFLAMALMGLKLWELA
SLALPMLAILVVQTIFMALYAIFVTWRMMGKNYDAAVLAAGHCGFGLGATPTAIANMQAI
TERFGPSHMAFLVVPMVGAFFIDIVNALVIKLYLMLPIFAG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtttcatctcgatactttagcaacgcttgttgccgcaacgctgacgttgttgctcggg
cgtaagttggtccattccgtctcctttttgaagaaatacaccataccggaacctgttgcg
ggtggtttgttggtggcgctggcgctactagtactgaaaaaaagcatgggctgggaagtc
aactttgatatgtccctgcgcgatccgttaatgctggctttcttcgccaccattggcctg
aacgccaacattgccagtttgcgtgccggtgggcgtgtggttggcatcttcttgattgtg
gttgttggtctgttggtgatgcaaaatgccattggcattggtatggctagcctgttaggg
cttgatccgctgatggggctgttggccggttctattacgctttccggcggtcacggtacg
ggcgctgcgtggagtaaattgttcattgaacgttatggcttcaccaatgcgacggaagtg
gcgatggcctgtgcaacgttcggtctggtgctgggcggcttgattggcggtccggtggcg
cgctatctggtgaaacactccaccacgccgaacggtattccggatgaccaggaagtcccg
acggcgtttgaaaagccggatgtgggccgcatgatcacctcgctggtgctgattgaaact
atcgcgctgattgctatctgcctgacggtggggaaaattgttgcgcaacttttggctggc
actgcttttgaactgccgaccttcgtctgtgtactgtttgttggcgtgattctgagcaac
ggtctgtcaatgatgggcttttaccgcgtctttgagcgtgcggtatccgtgctgggtaac
gtaagcctgtcgttgttcctggcgatggcgctgatggggctgaaactgtgggagctggct
tcgctggcgctgccgatgctggcgattctggtggtacagaccatcttcatggcgttgtat
gccatcttcgttacctggcgcatgatgggcaaaaactacgatgcggcagtgctggctgcg
ggtcactgtggttttggcctcggtgcaacgccaacggcaatcgccaacatgcaggcgatc
actgaacgctttggcccgtcgcacatggcgtttttggtggtgccgatggtcggtgcgttc
tttatcgatatcgtcaatgcgctggtgattaagctgtatttaatgttgccgatttttgcc
ggttaa

DBGET integrated database retrieval system