KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_5027Help
Entry
ECH74115_5027     CDS       T00778                                 

Gene name
yicE
Definition
(GenBank) xanthine permease
  KO
K16345  xanthine permease XanP
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecf02000]
    ECH74115_5027 (yicE)
Transporters [BR:ecf02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ECH74115_5027 (yicE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Xan_ur_permease SprB
Motif
Other DBs
NCBI-ProteinID: ACI34634
Position
4676596..4677987
Genome map
AA seq 463 aa AA seqDB search
MSVSTLESENAQPVAQTQNSELIYRLEDRPPLPQTLFAACQHLLAMFVAVITPALLICQA
LGLPAQDTQHIISMSLFASGVASIIQIKAWGPVGSGLLSIQGTSFNFVAPLIMGGTALKT
GGADVPTMMAALFGTLMLASCTEMVISRVLHLARRIITPLVSGVVVMIIGLSLIQVGLTS
IGGGYAAMSDNTFGAPKNLLLAGVVLALIILLNRQRNPYLRVASLVIAMAAGYALAWFMG
MLPESNEPMTQELIMVPTPLYYGLGIEWSLLLPLMLVFMITSLETIGDITATSDVSEQPV
SGPLYMKRLKGGVLANGLNSFVSAVFNTFPNSCFGQNNGVIQLTGVASRYVGFVVALMLI
VLGLFPAVSGFVQHIPEPVLGGATLVMFGTIAASGVRIVSREPLNRRAILIIALSLAVGL
GVSQQPLILQFAPEWLKNLLSSGIAAGGITAIVLNLIFPPEKQ
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtttccaccctcgagtcagaaaatgcgcaaccggttgcgcagactcaaaacagc
gaactgatttaccgtcttgaagatcgtccgccgcttcctcaaaccctgtttgccgcctgt
cagcatctgctggcgatgttcgttgcggtgatcacgccagcgctattaatctgccaggcg
ctgggtttaccggcacaagacacgcaacacattattagtatgtcgctgtttgcctccggt
gtggcatcgattattcaaattaaggcctggggtccggttggctccgggctgttgtctatt
cagggcaccagcttcaactttgttgccccgctgattatgggcggtaccgcgctgaaaacc
ggtggtgctgatgttcctaccatgatggcggctttgttcggcacgttgatgctggcaagt
tgcaccgagatggtgatctcccgcgttctgcatctggcgcgccgcattattacgccgctg
gtttctggcgttgtggtgatgattatcggcctgtcgctaattcaggttgggttaacgtcc
attggcggcggttacgcagccatgagcgataacaccttcggcgcaccgaaaaatctgctg
ctggcaggcgtggtcttagccttaattatcctgcttaaccgtcaacgtaacccttactta
cgcgtggcctcactggtgattgcgatggcggccggatatgcgctggcgtggtttatgggc
atgttgccagaaagcaacgaaccgatgacgcaagaactgattatggtgccaacgccgctc
tattacggtcttggcattgaatggagtctgctgctgccgctgatgctggtctttatgatc
acttcgctggaaaccattggcgatatcacggcgacctctgacgtttccgaacagccagtg
tccggtccgctgtacatgaaacgcctgaaaggcggcgtgctggcaaacggcctgaactcg
tttgtttcggcggtgtttaacaccttcccgaactcctgcttcgggcaaaacaacggagtg
atccagttgactggtgttgccagccgctatgtcggttttgtcgtcgcgctgatgttgatc
gtgctgggtctgttcccggcagtgagcggttttgtacaacacattccagaaccggttctg
ggcggcgcaacgcttgtaatgtttggcaccatcgccgcctccggtgtgcgtatcgtttct
cgtgagccgctgaaccgtcgggcgattctgattatcgcgctgtcgctggcggttggtctg
ggcgtgtctcagcagccgctgattttgcagtttgcccctgaatggctgaaaaacctgctc
tcctccgggatcgccgcgggcggtattactgccatcgtgctgaatctgattttcccacca
gaaaaacagtaa

DBGET integrated database retrieval system