KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_5037Help
Entry
ECH74115_5037     CDS       T00778                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_gyraseA_C
Motif
Other DBs
NCBI-ProteinID: ACI37438
Position
4687281..4687772
Genome map
AA seq 163 aa AA seqDB search
MMKLALTLEADSVNVQALNMGRIVVDIDGVNLAELINMVCDNGYSLRVVDESDRTSADCT
PPFTALTGIRCSTAHITETDNAWLYSLSHQTSDFGESEWIHFTGNGYLLRTDAWSYPVLR
LKRLGLSKTFRRLVVTLIRRYGVSLIHLDASAGCLPGLPTFNW
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaactggccctgacactggaagccgacagcgttaacgtacaggcactgaatatg
gggcgaattgtcgttgacattgatggtgttaatctcgctgaactgattaacatggtctgc
gataacggctactcccttcgtgttgttgatgaatctgaccggacctcagcagactgcacg
ccaccatttactgcccttaccggcatacgctgcagtaccgcacatatcacggaaacggac
aacgcctggctgtactcgctgtcacaccagaccagtgacttcggtgaatcagaatggatt
cattttaccggtaacggctatctgttgcgtaccgatgcgtggtcgtacccggttctgcgg
cttaaacgcctgggtctgtcaaaaacgttccgtcgtctggtcgtcacactcatccggcgt
tatggtgtcagtctcattcatctggatgccagtgccggatgtctgccaggtttacccact
tttaattggtaa

DBGET integrated database retrieval system