KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_5050Help
Entry
ECH74115_5050     CDS       T00778                                 

Definition
(GenBank) EspD
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SseC DUF2207 YqzE
Motif
Other DBs
NCBI-ProteinID: ACI36887
Position
complement(4695106..4696230)
Genome map
AA seq 374 aa AA seqDB search
MLNVNNDTLSVTSGVNTASGTSGITQSETGLSLDLQLVKSMNSSAGWTESSPLPTPPAGH
SLVTPSAAEDVLSKLFGGISGEVTSRTEEAEPQRTSYPYLSQVNTVDPQQMMMMVTLLSL
DTSAQKVSSLKNSNEIYMDGQTKALENKTQEYKKQLEEQQKAEEKSQKSKIVGQVFGWLG
VALTAVAAVFNPALWAVVAIGATAMALQTAVDVMGENAPQGLKTAAQVFGGISMAASILT
AGVGGVSSLLSKFGNVANKIGSSVVKVVEKAAEALVKNVFAKISTVAEGVTNGIRSAGTT
ALNNEAAQLQMLSQLAAFAVQNLTRQSESLGESAKLELDKAASELQNQASYLQSVSQLMS
DSARVNSRIVSGRI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgcttaacgtaaataacgataccctgtctgtaacgtctggggttaataccgcctcgggt
acttctggtattactcaatctgaaacgggtttatcgctggatttacaactggttaaatcc
atgaactcgtcagcaggctggacagaaagtagccctttaccgacgccgccggcaggtcac
tcattagtgacgccctctgctgctgaggatgtccttagtaaattgtttggtggtattagt
ggtgaggttacaagtcgcactgaggaggcagagccacagcgcacaagctatccctatctc
tctcaggtgaataccgttgaccctcagcaaatgatgatgatggtcactctgttatccctg
gatacttccgcgcagaaagtctcgagtctgaaaaactctaacgagatttatatggatggg
caaactaaagcgctggagaataaaacgcaggagtataaaaaacagctcgaagaacaacag
aaagccgaagagaaatcacaaaaaagtaaaattgttggccaggtctttggttggttgggc
gtcgcattaacagccgttgccgctgtttttaacccagcactctgggctgttgttgccatt
ggtgcaacagcaatggcactgcaaacggcagtcgatgtaatgggggaaaatgcccctcag
ggattaaagactgcagcacaggtctttggcggaatatctatggccgcaagcattctgaca
gccggcgttggcggggtgtcttcactgttatctaaatttggtaatgttgctaacaaaatt
ggctcaagcgttgtaaaagtcgttgagaaggcggcagaagcgctggttaaaaacgttttt
gcaaaaatttcgacagtggctgagggcgttacgaacggtattcgttctgccgggacaact
gcgttgaataatgaggctgcgcaactccaaatgttgtctcagttagctgctttcgcggtg
caaaacttaactcgacagagtgaaagcttaggtgagagtgcgaagctcgagctggataaa
gcggcaagcgagttacaaaatcaggcgagctatttacaaagtgtttctcaactgatgtcc
gattcagcacgggtaaatagtcgtattgttagtggccgaatttaa

DBGET integrated database retrieval system