KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_5055Help
Entry
ECH74115_5055     CDS       T00778                                 

Definition
(GenBank) Tir chaperone
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CesT DUF4945
Motif
Other DBs
NCBI-ProteinID: ACI37015
Structure
PDB: 

Position
complement(4702426..4702896)
Genome map
AA seq 156 aa AA seqDB search
MSSRSELLLEKFAEKIGIGSISFNENRLCSFAIDEIYYISLSDANDEYMMIYGVCGKFPT
DNSNFALEILNANLWFAENGGPYLCYEAGAQSLLLALRFPLDDATPEKLENEIEVVVKSM
ENLYLVLHNQGITLENEHMKIEEISSSDNKHYYAGR
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaagatctgaacttttattagaaaaatttgcagaaaaaattggtattggatct
atttcatttaatgaaaacagattgtgttcttttgctattgatgaaatttattatatttcg
ttatctgatgccaatgacgaatatatgatgatttatggtgtctgtgggaaattcccgaca
gataactctaacttcgctcttgagattttgaatgcaaacttatggtttgcagagaatggt
gggccatatctgtgctatgaggctggagcacaatcgctgttgttagcgttacgtttccct
ctcgatgatgctacccctgaaaaactcgagaatgaaatagaagtcgttgttaagtcaatg
gaaaacctgtatttggtattacataatcagggaataacattagaaaacgaacatatgaaa
atagaggaaatcagttcaagcgacaataaacattattacgccggaagataa

DBGET integrated database retrieval system