KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_5056Help
Entry
ECH74115_5056     CDS       T00778                                 

Definition
(GenBank) Tir
  KO
K12784  translocated intimin receptor
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf05130  Pathogenic Escherichia coli infection
Module
ecf_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05130 Pathogenic Escherichia coli infection
    ECH74115_5056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tir_receptor_N Tir_receptor_C Tir_receptor_M
Motif
Other DBs
NCBI-ProteinID: ACI36828
UniProt: B5YWI0
Structure
PDB: 

Position
complement(4703034..4704710)
Genome map
AA seq 558 aa AA seqDB search
MPIGNLGHNPNVNNSIPPAPPLPSQTDGAGGRGQLINSTGPLGSRALFTPVRNSMADSGD
NRASDVPGLPVNPMRLAASEITLNDGFEVLHDHGPLDTLNRQIGSSVFRVETQEDGKHIA
VGQRNGVETSVVLSDQEYARLQSIDPEGKDKFVFTGGRGGAGHAMVTVASDITEARQRIL
ELLEPKGTGESKGAGESKGVGELRESNSGAENTTETQTSTSTSSLRSDPKLWLALGTVAT
GLIGLAATGIVQALALTPEPDSPTTTDPDAAASATETATRDQLTKEAFQNPDNQKVNIDE
LGNAIPSGVLKDDVVANIEEQAKAAGEEAKQQAIENNAQAQKKYDEQQAKRQEELKVSSG
AGYGLSGALILGGGIGVAVTAALHRKNQPVEQTTTTTTTTTTTSARTVENKPANNTPAQG
NVDTPGSEDTMESRRSSMASTSSTFFDTSSIGTVQNPYADVKTSLHDSQVPTSNSNTSVQ
NMGNTDSVVYSTIQHPPRDTTDNGARLLGNPSAGIQSTYARLALSGGLRHDMGGLTGGSN
SAVNTSNNPPAPGSHRFV
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgcctattggtaatcttggtcataatcccaatgtgaataattcaattcctcctgcacct
ccattaccttcacaaaccgacggtgcaggggggcgtggtcagctcattaactctacgggg
ccgttgggatctcgtgcgctatttacgcctgtaaggaattctatggctgattctggcgac
aatcgtgccagtgatgttcctggacttcctgtaaatccgatgcgcctggcggcgtctgag
ataacactgaatgatggatttgaagttcttcatgatcatggtccgctcgatactcttaac
aggcagattggctcttcggtatttcgagttgaaactcaggaagatggtaaacatattgct
gtcggtcagaggaatggtgttgagacctctgttgttttaagtgatcaagagtacgctcgc
ttgcagtccattgatcctgaaggtaaagacaaatttgtatttactggaggccgtggtggt
gctgggcatgctatggtcaccgttgcttcagatatcacggaagcccgccaaaggatactg
gagctgttagagcccaaagggaccggggagtccaaaggtgctggggagtcaaaaggcgtt
ggggagttgagggagtcaaatagcggtgcggaaaacaccacagaaactcagacctcaacc
tcaacttccagccttcgttcagatcctaaactttggttggcgttggggactgttgctaca
ggtctgatagggttggcggcgacgggtattgtacaggcgcttgcattgacgccggagccg
gatagcccaaccacgaccgaccctgatgcagctgcaagtgcaactgaaactgcgacaaga
gatcagttaacgaaagaagcgttccagaacccagataatcaaaaagttaatatcgatgag
ctcggaaatgcgattccgtcaggggtattgaaagatgatgttgttgcgaatatagaagag
caggctaaagcagcaggcgaagaggccaaacagcaagccattgaaaataatgctcaggcg
caaaaaaaatatgatgaacaacaagctaaacgccaggaggagctgaaagtttcatcgggg
gctggctacggtcttagtggcgcattgattcttggtgggggaattggtgttgccgtcacc
gctgcgcttcatcgaaaaaatcagccggtagaacaaacaacaacaacaactactacaact
acaactacaagcgcacgtacggtagagaataagcctgcaaataatacacctgcacagggc
aatgtagatacccctgggtcagaagataccatggagagcagacgtagctcgatggctagc
acctcgtcgactttctttgacacttccagcatagggaccgtgcagaatccgtatgctgat
gttaaaacatcgctgcatgattcgcaggtgccgacttctaattctaatacgtctgttcag
aatatggggaatacagattctgttgtatatagcaccattcaacatcctccccgggatact
actgataacggcgcacggttattaggaaatccaagtgcggggattcaaagcacttatgcg
cgtctggcgctaagtggtggattacgccatgacatgggaggattaacgggggggagtaat
agcgctgtgaatacttcgaataacccaccagcgccgggatcccatcgtttcgtctaa

DBGET integrated database retrieval system