KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_5059Help
Entry
ECH74115_5059     CDS       T00778                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K12788  LEE-encoded effector EspH
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf05130  Pathogenic Escherichia coli infection
Module
ecf_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05130 Pathogenic Escherichia coli infection
    ECH74115_5059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACI37577
Position
complement(4706592..4707098)
Genome map
AA seq 168 aa AA seqDB search
MSLSGAVFKTFLTSEHASWNRFNRRLHIPNEDIVDEIQLKARMQQRHHRVYPEIGDSTIV
SFRGKDYAVHFIKDGPKDDYVYKVQRITPENGCFSTLFSVFSGGVTKALERKLNERHITP
LSSTWFPRTPLEGILAERGLSSLLRRVQSTERLDNRAIATRASSYSVL
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttatcaggagcggtattcaagacatttctgacaagtgaacatgcgtcatggaac
aggttcaacagaaggcttcatatacccaatgaagatatcgtagatgaaattcagcttaaa
gcccgaatgcaacaacgccatcatcgggtatatccagaaataggggattccaccattgtc
tcttttagaggcaaagactatgctgttcactttattaaagatggcccaaaagatgattat
gtgtacaaagtacaaagaataacaccggaaaatggatgtttctcaacgctatttagcgtg
ttttctggcggtgtgactaaggctttggaaagaaaattaaatgagagacatataactcca
ctttcttcaacctggtttcctcgtactcccctggaggggatcttagctgaaagaggatta
tcttctttgttacgtcgtgtacagtctaccgaacgtcttgataatagggctatagcaaca
agagcttcctcttatagcgtattatga

DBGET integrated database retrieval system