KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_5598Help
Entry
ECH74115_5598     CDS       T00778                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECH74115_5598
Enzymes [BR:ecf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     ECH74115_5598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2 AraC_binding Cupin_1 Catalase-rel
Motif
Other DBs
NCBI-ProteinID: ACI36169
Structure
PDB: 

Position
complement(5237351..5238034)
Genome map
AA seq 227 aa AA seqDB search
MKRSAINDILGHTRQFFSQHDVHLPPFASFSPAQWQQLDTAAWEEVFDLKLGWDVTAFGR
NNFAAHGLTLFTLRNGSAKGMPYVKCYAEKIMHVRDAQVTPMHFHWRKREDIINRGGGNL
IVELWNADSNEQTADSDITVVIDGCRQKHTAGSQLRLSPGESICLPPGLYHSFWAEAGFG
DVLVGEVSSVNDDDHDNHFLQPLDRYNLIDEDEPAQLVLCNEYRQFR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctccgctataaacgacattctcggccatacacggcaattcttttcgcaacat
gacgtacatctgccgccctttgccagtttctcgcctgctcaatggcagcagctcgacacc
gccgcgtgggaggaggtttttgatcttaaactcggctgggatgttaccgcttttggtcgc
aacaactttgcagcacacgggctgacgctgtttaccctacgtaacggctcagcaaaagga
atgccgtatgtgaaatgttacgccgagaagatcatgcatgtgcgcgatgcgcaggtcacg
ccaatgcattttcactggcgtaagcgtgaggacattatcaatcgcggcggcggtaattta
attgttgaactgtggaatgccgatagtaacgagcaaacggctgatagtgacattacggtg
gtgatagacggctgccgccagaaacatactgcaggctctcagttgcgcctgtctcccggc
gaaagtatctgcctgccgcccggcctgtatcacagcttttgggcagaagccggttttggc
gatgtgctggttggcgaagtctcttctgttaatgacgacgaccacgataaccacttttta
cagccactggaccgctacaacctgattgacgaagacgaacctgcacagttggtattgtgt
aacgaataccgccagttccgctga

DBGET integrated database retrieval system