KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_A0013Help
Entry
ECH74115_A0013    CDS       T00778                                 

Definition
(GenBank) conjugal transfer protein TraG
  KO
K03203  type IV secretion system protein VirB8
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf03070  Bacterial secretion system
Module
ecf_M00333  Type IV secretion system
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECH74115_A0013
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecf02044]
    ECH74115_A0013
Secretion system [BR:ecf02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein [MD:M00333]
   ECH74115_A0013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8 Myb_DNA-bind_6 Desmo_N
Motif
Other DBs
NCBI-ProteinID: ACI39882
Position
pEC4115:8167..8904
Genome map
AA seq 245 aa AA seqDB search
MDLKNKYFGKTKEEAAKKKIDIKKENKQIFDAVKQFERNEIATVQGKAKFITRIAVVLLI
SNIALAAAIAFLSPLKTAVPFVIRVDNNTGYTDIAPQLSGAKQTYQEAETKYNLAKFVIN
YESYDWQTIQEMLDTVNVMSNNKVFSQYNTAIRADNSPLNVLKDSYKIKTKIKSVTLLKP
DVAQVRFSKMILDSSGSLAPEYRVTDWIATVAFDFNKDVKTEEQRLINPLGFEAVSYRVD
AEAIK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggatttaaaaaataaatattttggtaagacaaaagaagaagcggctaagaaaaaaatt
gatataaagaaagaaaacaagcaaatttttgatgctgtcaagcagtttgagcgtaatgaa
atagcaaccgtccagggtaaagccaagtttattacgcgaattgctgttgtgctgttgatt
tccaatattgctcttgcagcagccatcgcttttttgtctccgttaaagactgccgttcct
tttgttattcgtgtggataacaatacgggctatacagatattgcaccgcaattatcagga
gcaaagcaaacctatcaggaggcagaaacaaaatataatcttgcgaagtttgttattaac
tatgagtcatacgactggcagactatccaggaaatgctggatacggtaaatgtcatgtct
aataacaaagtgttctcgcagtacaatacagctattcgtgcagataactcgccgctgaat
gtactgaaagacagttataagattaaaacgaaaattaagtctgttactttactaaagcct
gatgttgcgcaggtcagattctcaaaaatgattcttgactcttccggctctttggctccc
gaatacagagttacagactggattgcaacggtcgcgtttgattttaataaagatgttaag
acggaagaacaacggcttattaatcctctcggatttgaagctgtcagctatcgtgtagac
gcggaggctattaaatga

DBGET integrated database retrieval system