KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_0009Help
Entry
E2348C_0009       CDS       T00796                                 

Gene name
mog
Definition
(GenBank) predicted molybdochelatase
  KO
K03831  molybdopterin adenylyltransferase [EC:2.7.7.75]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg00790  Folate biosynthesis
ecg01100  Metabolic pathways
ecg04122  Sulfur relay system
Module
ecg_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    E2348C_0009 (mog)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    E2348C_0009 (mog)
Enzymes [BR:ecg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     E2348C_0009 (mog)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoCF_biosynth
Motif
Other DBs
NCBI-ProteinID: CAS07557
UniProt: B7UI54
Structure
PDB: 

Position
9202..9789
Genome map
AA seq 195 aa AA seqDB search
MNTLRIGLVSISDRASSGVYQDKGIPALEEWLTSALTTPFELETRLIPDEQAIIEQTLCE
LVDEMSCHLVLTTGGTGPARRDVTPDATLAVADREMPGFGEQMRQISLHFVPTAILSRQV
GVIRKQALILNLPGQPKSIKETLEGVKDAAGNVVVHGIFASVPYCIQLLEGPYIETAPEV
VAAFRPKSARRDVSE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaatactttacgtattggcttagtttccatctctgatcgcgcatccagcggcgtttat
caggataaaggcatccctgcgttggaagaatggctgacatcggcgctaaccacgccgttt
gaactggaaacccgcttaatccccgacgagcaggcgatcatcgagcaaacgttgtgtgag
ctggtggatgaaatgagttgccatctggtgctcaccacgggcggaactggcccggcgcgt
cgtgacgtaacgcccgatgcgacgctggcagtagcggaccgcgagatgcctggctttggt
gaacagatgcgccagatcagcctgcattttgtaccaactgcgatcctttcgcgtcaggtg
ggcgtgattcgcaaacaggcgctgatccttaacttacccggtcagccgaagtcgattaaa
gagacgctggaaggcgtgaaggacgctgcgggtaacgttgtggtgcatggtatttttgcc
agcgtaccgtactgcattcagttgctggaagggccatacattgaaacggcaccggaagtg
gttgcagcattcagaccgaagagtgcaagacgcgacgttagcgaataa

DBGET integrated database retrieval system