KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_0867Help
Entry
E2348C_0867       CDS       T00796                                 

Gene name
ltaE
Definition
(GenBank) L-allo-threonine aldolase, PLP-dependent
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg00260  Glycine, serine and threonine metabolism
ecg01100  Metabolic pathways
ecg01110  Biosynthesis of secondary metabolites
ecg01120  Microbial metabolism in diverse environments
ecg01130  Biosynthesis of antibiotics
ecg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    E2348C_0867 (ltaE)
Enzymes [BR:ecg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     E2348C_0867 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 CheD
Motif
Other DBs
NCBI-ProteinID: CAS08415
UniProt: B7UMW2
Structure
PDB: 

Position
complement(906582..907583)
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPSRAMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQ
ANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKI
KPDDIHFARTKLLSLENTHNGKVLPREYLKEAWEFTRERNLALHVDGARIFNAVVAYGCE
LKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMY
ALKNNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVL
INASPIVRLVTHLDVSREQLAEVAAHWHAFLAR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttacgcagtgataccgttacccgaccgagccgcgccatgctcgaagcgatg
atggccgccccggttggggacgacgtttacggagacgaccctaccgttaatgctctgcag
gactatgcagcagagctttccggtaaagaagccgccatttttctgcctaccggcactcag
gccaacctggtcgctctgctcagtcactgcgaacgcggcgaagagtatatcgtcggtcag
gccgcgcataactatctgtttgaagccggtggcgcagcagtgctgggcagtattcagccg
caacccatcgacgcagctgccgacggcacgctaccgctggataaagtggcgatgaaaatc
aaacccgacgatatccatttcgcccgcaccaaattactcagtctggaaaacacccacaac
ggcaaagtgctgccgcgtgaatacctgaaagaagcatgggaatttacccgcgagcgcaat
ctggcgctgcacgttgacggcgcgcgcatttttaatgccgtggtggcttacggctgcgaa
ctgaaagagatcacgcaatattgtgactcgttcaccatttgcctgtcaaaaggtcttggg
acgccagtcggttcattactcgtcggtaatcgtgattacattaaacgtgccattcgctgg
cggaaaatgacaggtggcgggatgcgtcagtccggcattctggctgccgccgggatgtat
gccctgaaaaataacgtcgcacgtttgcaggaagaccacgataacgccgcctggatggcg
gagcagttgcgtgaagcaggcgcggatgtgatgcgtcaggacaccaatatgctgtttgtt
cgcgtcggggaagaaaatgctgccgcgttaggcgaatacatgaaagcgagaaacgtgctg
attaacgcctcgccgattgtccgcctggtgacccatcttgacgtctcgcgtgaacaactg
gcggaagttgccgcccactggcatgcgttcctggcgcgttaa

DBGET integrated database retrieval system