KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_1331Help
Entry
E2348C_1331       CDS       T00796                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methylerythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg00900  Terpenoid backbone biosynthesis
ecg01100  Metabolic pathways
ecg01110  Biosynthesis of secondary metabolites
ecg01130  Biosynthesis of antibiotics
Module
ecg_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ecg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    E2348C_1331 (ispE)
Enzymes [BR:ecg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     E2348C_1331 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CAS08879
UniProt: B7UQ96
Structure
PDB: 

Position
complement(1371052..1371903)
Genome map
AA seq 283 aa AA seqDB search
MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTISIELRDDGDIRLLTPVEGV
EHEDNLIVRAARLLMKTAADSGRLSTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNH
LWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEIFTPVDPPEKWYLVAHPGVSIP
TPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDVVLSWLLEYAPSRLTGT
GACVFAEFDTESEARQVLEQAPEWLNGFVARGVNLSPLHRAML
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcggacacagtggccctctccggcaaaacttaatctgtttttatacattaccggtcag
cgtgcggatggttaccacacgctgcaaacgctgtttcagtttcttgattacggcgacacc
atcagcattgagcttcgtgacgatggggatattcgtctgttaacgcccgttgaaggcgtg
gaacatgaagataacctgatcgttcgcgcagcgaggttgttgatgaaaactgcggcagac
agcgggcgtctttcgacgggaagcggtgcgaatatcagcattgacaagcgtttgccgatg
ggcggcggtctcggcggtggttcatccaatgccgcgacggttctggtggcgttaaatcat
ctctggcaatgcggactaagcatggatgaactggcggaaatggggctgacgctgggcgca
gatgttcctgtctttgtccgtggtcatgccgcctttgccgaaggtgttggcgaaatattc
acgccggtagacccgccagagaaatggtatctggtcgcacaccctggcgtgagtattccg
acgccggtgatttttaaagatcctgaactcccgcgcaatacgccaaaaaggtcaatagaa
acgttgctaaaatgtgaattcagcaatgattgcgaggttatcgcaagaaaacgttttcgc
gaggttgatgtggtgctttcctggctgttagaatacgccccgtcgcgcctgactgggaca
ggggcctgtgtctttgctgaatttgatacggagtctgaagcccgccaggtgctagagcaa
gccccggaatggctcaatggctttgtggcgagaggcgttaatctttccccattgcacaga
gccatgctttaa

DBGET integrated database retrieval system