KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_1646Help
Entry
E2348C_1646       CDS       T00796                                 

Gene name
yneI
Definition
(GenBank) predicted aldehyde dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg00250  Alanine, aspartate and glutamate metabolism
ecg00650  Butanoate metabolism
ecg00760  Nicotinate and nicotinamide metabolism
ecg01100  Metabolic pathways
ecg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    E2348C_1646 (yneI)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    E2348C_1646 (yneI)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    E2348C_1646 (yneI)
Enzymes [BR:ecg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     E2348C_1646 (yneI)
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     E2348C_1646 (yneI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh baeRF_family2
Motif
Other DBs
NCBI-ProteinID: CAS09194
UniProt: B7URQ2
Position
complement(1711034..1712422)
Genome map
AA seq 462 aa AA seqDB search
MTITPATHAISINPATGEQLSVLPWAGVDDIENALQLAAAGFRDWRETNIDYRAEKLRDI
GKALRARSEEMAQMITREMGKPINQARAEVAKSANLCDWYAEHGPAMLKAEPTLVENQQA
VIEYRPLGTILAIMPWNFPLWQVMRGAVPIILAGNGYLLKHAPNVMGCAQLIAQVFKDAG
IPQGVYGWLNADNDGVSQMIKDSRIAAVTVTGSVRAGAAIGAQAGAALKKCVLELGGSDP
FIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIIEEGIASAFTERFVAAAAALKMGDP
RDEENALGPMARFDLRDELHHHVEKTLAQGARLLLGGEKMAGAGNYYPPTVLANVTPEMT
AFREEMFGPVAAITIAKDAEHALELANDSEFGLSATIFTTDETQARQMAARLECGGVFIN
GYCASDARVAFGGVKKSGFGRELSHFGLHEFCNIQTVWKDRV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaccattactccggcaactcatgcaatttcgataaatcctgccaccggtgaacaactt
tctgtgctgccgtgggctggtgttgacgatatcgaaaacgcacttcagctggcggcagca
ggctttcgcgactggcgcgagacaaatatagattatcgtgctgaaaaactgcgtgatatc
ggtaaggctctgcgcgcccgtagcgaagaaatggcgcaaatgatcacccgtgaaatgggc
aaaccaatcaaccaggcgcgcgctgaagtggcgaaatcggcgaatttgtgtgactggtat
gcagaacatggtccggcaatgctgaaggcggaacctacgctggtggaaaatcagcaggcg
gttattgagtatcgaccgttggggacgattctggcgattatgccgtggaattttccgtta
tggcaggtgatgcgtggtgctgttcccatcattcttgctggtaacggctacttacttaaa
catgcgccgaatgtgatgggctgtgcacagctcattgcccaggtgtttaaagatgcgggt
atcccacaaggcgtatatggctggctgaatgccgacaacgacggtgtcagtcagatgatt
aaagactcgcgcattgctgctgtcacagtgaccggaagtgttcgtgctggagcggctatt
ggcgcacaggctggagcggcactgaaaaaatgcgtactggaactgggtggttcggatccg
tttattgtgcttaacgatgccgatctggaactggcggtgaaagcggcggtagccggacgt
tatcagaataccggacaggtttgtgcagcggcaaaacgctttatcatcgaagagggaatt
gcttcggcatttaccgaacgttttgtggcagctgcggcagccttgaaaatgggcgatccc
cgtgatgaagagaatgctctcggaccaatggctcgttttgatttacgtgatgagctgcat
catcatgtggaaaaaacactggcgcagggtgcgcgtttgttactgggcggggaaaagatg
gctggggcaggtaactactatccgccaacggttctggcgaatgttaccccagaaatgacc
gcgtttcgggaagaaatgtttggccccgttgcggcaatcaccattgcgaaagatgcagaa
catgcgctggaactggctaatgatagtgagttcggcctttcagcgaccattttcaccacc
gacgaaacacaggccagacagatggcggcacgtctggaatgcggtggggtgtttatcaat
ggttattgtgccagcgatgcgcgagtcgcctttggtggcgtgaagaagagtggctttggg
cgtgagctttcccattttggcttacacgaattctgtaatatccagacggtgtggaaagac
cgggtctga

DBGET integrated database retrieval system