KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_2923Help
Entry
E2348C_2923       CDS       T00796                                 

Gene name
ihgO
Definition
(GenBank) L-2-hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg00310  Lysine degradation
ecg01100  Metabolic pathways
ecg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    E2348C_2923 (ihgO)
Enzymes [BR:ecg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     E2348C_2923 (ihgO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Mqo Pyr_redox_2 Amino_oxidase NAD_binding_8 FAD_binding_2 Trp_halogenase Thi4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CAS10471
UniProt: B7UH79
Position
3015846..3017114
Genome map
AA seq 422 aa AA seqDB search
MYDFVIIGGGIIGMSTAMQLIDVYPDARIALLEKESGPACHQTGHNSGVIHAGVYYTPGS
LKAQFCLAGNRATKAFCDQNGIRYDNCGKMLVATSELEMERMRALWERTAANGIEREWLN
AEELREREPNITGLGGIFVPSSGIVSYREVTAAMAKIFQARGGEIIYNAEVSALSEHKNG
VVIRTRQGGEYEASTLISCSGLMADRLVKMLGLEPGFIICPFRGEYFRLAPEHNQIVNHL
IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLAFKREGYRKRDFSFSDTLEILGSSGIRR
VLQNHLRSGLGEMKNSLCKSGYLRLVQKYCPRLSLSDLQPWPAGVRAQAVSPDGKLIDDF
LFVTTPRTIHTCNAPSPAATSAILIGAHIVSKVQTLLASQSNPGRTLRAARSVDALHAAF
NQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtatgattttgtgattattggcggcggcatcatcggcatgtcgaccgccatgcaactg
attgatgtttatccggatgcccgcattgcgttgctggaaaaagagtccggcccggcctgt
caccagacgggccacaacagcggcgtgatccatgctggggtctattacacgcccggcagc
ctgaaggcgcagttttgcctggcgggaaaccgcgccaccaaagccttttgcgatcaaaac
ggcattcgctatgacaactgcggcaagatgctggtcgccacctctgaactcgaaatggaa
cggatgcgcgcgttgtgggaacgcacggcggcgaacggtatcgagcgcgagtggttaaac
gccgaggaactgcgcgagcgcgaaccgaatatcaccgggcttggcggcatttttgtgccg
tccagcggcattgtcagctatcgcgaagtgacggcggcgatggcaaaaatcttccaggcc
agaggcggcgagattatttataacgccgaagtcagcgcccttagtgagcataaaaacggc
gtggtgatacgtacccgtcagggcggtgaatatgaagcatcgacgctgattagctgttcc
gggctgatggctgaccggctggtgaaaatgctcggcctcgaaccgggctttattatctgc
ccgttccgtggcgagtatttccgccttgcgccggagcataaccagattgttaaccacctg
atttaccccattcccgaccccgcgatgccatttttgggcgtgcatctcacccgcatgatc
gatggcagcgtgaccgtcgggccaaacgcggtgctggcttttaaacgcgaaggctatcgc
aagcgcgatttctcgtttagtgacacgctggagattttaggctcgtcggggattcgccgg
gtgctgcaaaaccatctacgctcaggattgggcgagatgaaaaactcgctgtgcaaaagc
ggctatctgcggctggtgcaaaagtattgtccccggctttcgttaagcgatctccagccc
tggcccgcaggtgtgcgggcgcaggcggtatcgccggacggcaagctgattgacgatttt
ctgtttgtcaccaccccgcgcacgatccacacctgcaatgcgccctccccggcagcgaca
tcagcaattcttattggtgcgcatattgtcagcaaggtacaaacgctgttggcaagccag
agtaaccccggacgcacgctgcgagcggcacgtagtgtggatgccttacacgccgcattt
aatcaataa

DBGET integrated database retrieval system