KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_3042Help
Entry
E2348C_3042       CDS       T00796                                 

Gene name
scrB
Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg00052  Galactose metabolism
ecg00500  Starch and sucrose metabolism
ecg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    E2348C_3042 (scrB)
   00500 Starch and sucrose metabolism
    E2348C_3042 (scrB)
Enzymes [BR:ecg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     E2348C_3042 (scrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: CAS10590
UniProt: B7UHJ1
Position
3134170..3135579
Genome map
AA seq 469 aa AA seqDB search
MSMPSQMPAILQAVMKGQSKALADAHYPCWHLAPVTGLMNDPNGFCWSGGRYHLFYQWNP
LACDHKYKCWGHWSSTDLLHWQHEPLALMPDKEYDRNGCYSGSAVNNQGVLTLCYTGNVK
FDDGSRTAWQCLATENNQGGFDKLGPVIPLPDGYTGHVRDPKVWKHNSQWYMVLGAQDKE
KRGKVLLYSSVDLYTWSFHGEIAGNGLNEIDNAGYMWECPDLFALDGEYILLCCPQGMVR
EHERYLNTYPCAWLHGQFDYETGKFTHGAFSELDAGFEFYAPQTMEAPDGRRLLVGWMGV
PDGEEMLQPTRKHHWQHQMTCFRELSFQKGKLFQMPIRELAQLREAEHFWQGKADHAPHV
EIERLEMDIIPSGELYLNFGNALALHLNDDGIQLQRRSLAGQEKLTRYWRGSVTSLKILC
DSSSVEIFINNGEGVMSNRYFPHHPASLILQGESDVTLRYWSLRACMVE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgccttcacaaatgcccgcgattttacaggcagtgatgaaaggtcagtccaaa
gcactggcagatgcccactatccttgttggcatctcgctccagtcaccggactaatgaac
gatccaaatggcttttgttggtctggaggccgctatcatctgttttatcaatggaatcca
ctggcttgtgatcataagtacaaatgttgggggcactggagttcgacggatttattgcac
tggcagcatgaaccattagcgctaatgcccgataaagagtacgaccgtaatggttgttac
tcaggaagcgcggttaataatcagggcgttctcacactttgctataccggtaatgttaag
tttgatgatggcagcagaacggcatggcaatgcctggccaccgaaaataaccagggcggg
tttgataaactaggccctgtcataccgttacctgatggttacaccggacatgttcgtgat
ccaaaagtctggaagcacaacagccaatggtacatggtgcttggcgcgcaagataaagag
aaacgggggaaagtgctgctgtattcctctgtcgatctctatacctggtcttttcatgga
gaaattgctggtaacggtctgaatgaaatagataacgcaggatacatgtgggaatgtcct
gatcttttcgcccttgatggtgaatacattctcctctgttgcccccagggaatggtgcgc
gaacatgagcgctatctgaatacttatccctgcgcctggctacatggacagtttgattac
gagacaggcaaatttacgcatggcgctttctcagagctggatgcgggatttgaattctat
gcaccacagacgatggaagccccggacgggcgacgattgctggtcggctggatgggggtt
cctgatggcgaagagatgttgcagccaaccagaaagcatcattggcagcatcaaatgacc
tgttttcgcgaactctcattccagaagggaaaattgtttcagatgccaatcagggaactc
gcgcaactgcgtgaagctgaacacttctggcaaggaaaagcggatcatgcgccgcatgtc
gaaattgaacgcctggaaatggacatcattccgtcgggtgagctgtatctgaattttggc
aatgcgctggcactgcatcttaatgacgatggtattcaactacagaggagaagccttgca
gggcaagagaaactaactcgttactggcgaggaagcgtaacgtcactgaagattctctgt
gacagttccagcgtagagatattcatcaataatggtgaaggtgtaatgagtaatcgttat
tttccccatcatccagcttcgctgatattacagggtgagtctgacgtcacgttacgctac
tggtcgctacgcgcctgcatggtagaatga

DBGET integrated database retrieval system