KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_3120
Entry
E2348C_3120       CDS       T00796                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase, Fe-S binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg00230  Purine metabolism
ecg01100  Metabolic pathways
ecg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    E2348C_3120 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: CAS10668
UniProt: B7UHR8
Position
3230758..3231237
AA seq 159 aa
MNHSETITIECVINGMPFQLHAAPGMPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLFLAAWAEGKEIRTLEGEAKGGKLSHVQLAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcgtcattaacggaatgccttttcagctt
cacgccgcgccaggaatgccgctttcggaactactccgagaacaagggcttcttagtgtc
aaacaaggttgctgcgtaggcgaatgcggtgcctgtacggtgctggtcgacggcactgcg
atagacagttgcttattccttgcggcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggtaaactttctcatgtccaactggcttatgcgaaatccggcgca
gtgcaatgcgggttttgtacgccgggcctgattatggctaccacggcgatgctggcaaaa
ccacgcgaaaaaccattaaccattacggaaattcgtcgtggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system