KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_3446Help
Entry
E2348C_3446       CDS       T00796                                 

Gene name
rpsO
Definition
(GenBank) 30S ribosomal subunit protein S15
  KO
K02956  small subunit ribosomal protein S15
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg03010  Ribosome
Module
ecg_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    E2348C_3446 (rpsO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ecg03011]
    E2348C_3446 (rpsO)
Ribosome [BR:ecg03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    E2348C_3446 (rpsO)
  Bacteria
    E2348C_3446 (rpsO)
  Archaea
    E2348C_3446 (rpsO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S15 FliJ Stirrup
Motif
Other DBs
NCBI-ProteinID: CAS10994
UniProt: B7UJ60
Structure
PDB: 

Position
complement(3589695..3589964)
Genome map
AA seq 89 aa AA seqDB search
MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMV
SQRRKLLDYLKRKDVARYTQLIERLGLRR
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgtctctaagtactgaagcaacagctaaaatcgtttctgagtttggtcgtgacgcaaac
gacaccggttctaccgaagttcaggtagcactgctgactgcacagatcaaccacctgcag
ggccactttgcagagcacaaaaaagatcaccacagccgtcgtggtctgctgcgcatggtt
tctcagcgtcgtaaactgctcgactacctgaaacgtaaagacgtagcacgttacacccag
ctcatcgagcgcctgggtctgcgtcgctaa

DBGET integrated database retrieval system