KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_3846Help
Entry
E2348C_3846       CDS       T00796                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate dehydrogenase, NAD(P)-binding
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg00051  Fructose and mannose metabolism
ecg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    E2348C_3846 (mtlD)
Enzymes [BR:ecg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     E2348C_3846 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N AfaD
Motif
Other DBs
NCBI-ProteinID: CAS11394
UniProt: B7ULF5
Position
4016737..4017885
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGETEQVDTV
SGVDAVSSIGDDVVDLIAQVDLVTTAVGPVVLERIAPAIAKGLVKRKEQGNESPLNIIAC
ENMVRGTTQLKGHVMNALPEDAKAWVEEHVGFVDSAVDRIVPPSASATNDPLEVTVETFS
EWIVDKTQFKGTLPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DEKIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHKNLIEGIAAAMHFRSEDDPQAQELAALIADKGPQAALAQ
ISGLDANNEVVSEAVTAYKAMQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggtcgtggctttatcggtaaactgctg
gcggacgcgggtatccaactgacgtttgccgatgtaaatcaggtggtacttgatgccctg
aatgcccgtcatagctatcaggttcatgtggttggtgaaaccgagcaggtagataccgtt
tctggcgtcgatgccgtcagcagcattggcgatgatgtcgttgatctgattgctcaggtc
gatttagtcactaccgccgttggccctgtcgtgctggaacgtattgctccggccatcgcc
aaagggctggtgaaacgtaaagaacaaggtaatgaatccccactgaacatcatcgcctgt
gaaaacatggtccgcggcaccacgcagctgaaaggccatgtgatgaacgccctgccggaa
gatgccaaagcgtgggtagaagaacacgttggctttgttgattccgccgttgaccgcatc
gtaccgccttcggcttcggcaactaacgatccgctggaagtgacggtagaaaccttcagc
gaatggattgtcgataaaacgcagttcaaaggcacgctgccaaacatccctggcatggaa
ttaaccgacaatctgatggcatttgtcgaacgtaaactcttcaccctgaatacaggtcat
gctataaccgcgtacctcggaaaactggccggtcatcagaccattcgtgacgcaattctc
gacgagaaaatccgcgcggtggtaaaaggggcaatggaagaaagcggcgcggtactgatc
aagcgctacggctttgatgctgacaaacatgcggcatacatccagaaaatcctcggtcgt
ttcgagaacccatacctgaaagatgatgtagaacgcgtaggccgtcagccgctgcgtaaa
ctgagtgctggtgaccgtctgatcaaaccactgctcggaaccctggaatatggtctgcca
cataaaaacctgattgaaggtattgccgctgcaatgcacttccgcagtgaagatgatccg
caggctcaggaactggcagcgctgattgccgacaaaggcccacaagccgcgctggcacag
atttccggtcttgatgccaacaacgaggttgtatccgaggcggtaaccgcttataaagca
atgcaataa

DBGET integrated database retrieval system