KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_4333Help
Entry
E2348C_4333       CDS       T00796                                 

Definition
(GenBank) sorbose-permease PTS system IIB component
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg00051  Fructose and mannose metabolism
ecg01100  Metabolic pathways
ecg02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    E2348C_4333
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    E2348C_4333
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecg02000]
    E2348C_4333
Enzymes [BR:ecg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     E2348C_4333
Transporters [BR:ecg02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    E2348C_4333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: CAS11881
UniProt: B7UPH9
Position
complement(4564039..4564533)
Genome map
AA seq 164 aa AA seqDB search
MNITLARIDDRLIHGQVTTVWSKVANAQRIIICNDEVYNDEVRRTLLRQAAPPGMKVNVV
NIEKAVAVYHNPQYQDETVFYLFTRPQDALAMVRQGVKIGTLNIGGMAWRPGKKQLTKAV
SLDDDDINAFHELNNLGVILDLRVVASDPSINIIDKINEQLIAN
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacattacgctcgcccgcattgatgaccgcctgatccacggccaggtcactaccgtc
tggtcgaaagtggctaacgcccaacgcattattatctgcaatgacgaagtttataacgat
gaagttcgccggacattattgcgtcaggctgcgccaccgggaatgaaggttaacgtggtc
aatattgaaaaagccgtcgcggtttatcacaacccgcaatatcaggacgaaaccgttttt
tatcttttcactcgcccacaagatgccttagcaatggttcgccagggggtaaaaataggt
accctgaatattggcggtatggcctggcgtcctggtaagaaacagttaaccaaagcagtt
tcattagatgacgatgatattaacgcatttcatgagttaaataatcttggcgtcatactg
gatttacgcgtcgtagcgtcagatccctcaatcaatattatcgacaaaataaacgaacag
ttaatcgcaaattaa

DBGET integrated database retrieval system