KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_4378Help
Entry
E2348C_4378       CDS       T00796                                 

Definition
(GenBank) predicted sensory histidine kinase in two-component system
  KO
K10125  two-component system, NtrC family, C4-dicarboxylate transport sensor histidine kinase DctB [EC:2.7.13.3]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    E2348C_4378
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecg01001]
    E2348C_4378
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ecg02022]
    E2348C_4378
Enzymes [BR:ecg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     E2348C_4378
Protein kinases [BR:ecg01001]
 Histidine kinases
  NtrC family
   E2348C_4378
Two-component system [BR:ecg02022]
 NtrC family
  DctB-DctD (C4-dicarboxylate transport)
   E2348C_4378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c dCache_1 HATPase_c_5 HisKA sCache_3_2 HATPase_c_2 DinB GRDA HATPase_c_3 DUF4381 DUF2681
Motif
Other DBs
NCBI-ProteinID: CAS11926
UniProt: B7UPM3
Position
complement(4614272..4616092)
Genome map
AA seq 606 aa AA seqDB search
MKISWNYIFKNKWRFHITSISLFLIMLAVSIAFLHLRFNTLSGTDKMRLEMYKSTLYSTI
EQFYVLPYMLSTDHIIRQAVITPDDMMSSELNQRIAHFNTQLKTAAIFILDTQGKAIASS
NWQDPGSYVGQNYSYRPYYKHAMSGLNGRFYGIGSTTNTPGFFLSTSIKDKGKIVGVVVV
KISLNEIEKAWAEGPENIIVNDEHGIIFLSSKSPWRMRTLQPLPVQAKQKLQSTRQYSLD
NLLPADYYPCYTVSNFTFLKDKKEQLCLFPQYYTQQIAIPEFNWKMTIMVPLDNLYWSWA
ISLVITLIIYLLFLLFIKYWRMRSHAQQLLTLANETLEKQVKERTSALELINQKLIQEIK
ERSQAEQVLQITRSELAESSKLAALGQMATEIAHEQNQPLAAIHALTDNARTMLKKEMYP
QVEQNLKHIISVIERMTQLISELKAFASRHRVPKGSADVIKVMYSAVALLNHSMEKNNIE
RRIKAPSMPLFVNCDELGLEQIFSNLISNALDSMEGSSYKRLDIAIRQANNKVIITIKDS
GGGFAPEVVDRIFEPFFTTKRRGMGLGLAIVSEIVRNSNGALHASNHPEGGAVMTLTWPE
WGEEHE
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatcgtggaattatatatttaagaacaaatggcgatttcacattacaagcatt
tcactttttcttatcatgctcgcggtttcaatcgcttttttgcacttgcgttttaatacc
ttgtccggtaccgataaaatgcggcttgaaatgtataagtccacattatattccaccatc
gagcaattttatgttttaccctatatgctctcaacagaccatatcatccgtcaggcggta
attacgcctgacgatatgatgtccagcgaactcaatcaacgaattgcacatttcaatact
caactcaaaaccgcagcaatatttattctggatacccaaggtaaggccatcgcttctagc
aactggcaggaccccggcagctatgtagggcaaaattatagctatcgcccctattataaa
cacgccatgtctggcttaaatggacgcttttacggtattggtagcactacgaatacaccg
ggattcttcctctctacaagtataaaagataaaggaaaaattgtcggtgttgtagtagta
aaaataagtcttaatgaaattgaaaaagcatgggccgaaggtcctgaaaatattatcgtg
aatgatgaacatgggattatatttttaagttcaaaatcgccatggcgaatgcgaacactg
caaccgttacctgttcaggcaaaacaaaaactacaatctacccgccaatatagtctcgac
aatcttttaccggcggattattatccctgttataccgtgagcaattttactttcctgaaa
gataaaaaagaacaactctgtttattcccgcaatattatacgcaacaaatagccattcca
gaatttaactggaaaatgacaattatggtccccttagataacctgtactggtcatgggct
atttcgttagtcattacgctaattatttacctgctgtttttgttatttattaaatactgg
agaatgcgatctcatgcacaacaattattaacactggcgaatgaaacattagagaaacag
gttaaagagcgtacatctgccctggaattgatcaatcaaaaattaatacaggagataaaa
gagcgcagtcaggctgaacaagtattacaaattacgcgtagtgaactggcagagtccagc
aaactggcggcgcttggacagatggcaaccgaaattgcccatgaacaaaatcaaccgtta
gccgccattcacgcacttactgataacgcgcgtactatgctaaaaaaagagatgtatccg
caggttgaacagaatctgaaacacattatttcagtgattgagcggatgacgcagctcatt
tccgaacttaaagcatttgcctcgcgccatcgcgtacctaaaggttctgccgatgtcatc
aaagtgatgtatagcgccgtggcgttacttaatcacagcatggagaaaaataatattgag
cgacgaataaaagccccatccatgccgttatttgtcaattgcgatgagctcggtcttgaa
cagatattcagtaatttaattagcaacgccttagattctatggaaggtagctcttacaaa
cgactggatatcgccattcgccaggcaaataacaaagttattattaccattaaagacagc
ggtggcggttttgcacctgaagttgtcgatcgcatatttgaaccattttttaccactaaa
cgtagaggaatggggttgggactggcaatagtcagcgaaattgtccgaaattcgaacggc
gcactccacgccagtaatcatcctgaaggcggcgcagtaatgacattaacctggcctgaa
tggggagaagaacatgaataa

DBGET integrated database retrieval system