KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_4392Help
Entry
E2348C_4392       CDS       T00796                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg00010  Glycolysis / Gluconeogenesis
ecg00620  Pyruvate metabolism
ecg00640  Propanoate metabolism
ecg00680  Methane metabolism
ecg01100  Metabolic pathways
ecg01110  Biosynthesis of secondary metabolites
ecg01120  Microbial metabolism in diverse environments
ecg01130  Biosynthesis of antibiotics
ecg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ecg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    E2348C_4392 (acs)
   00620 Pyruvate metabolism
    E2348C_4392 (acs)
   00640 Propanoate metabolism
    E2348C_4392 (acs)
  Energy metabolism
   00680 Methane metabolism
    E2348C_4392 (acs)
Enzymes [BR:ecg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     E2348C_4392 (acs)
Lipid biosynthesis proteins [BR:ecg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   E2348C_4392 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAS11940
UniProt: B7UPN7
Position
complement(4630919..4632877)
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHTIPANIADRCLINPQQYEAMYQQSINAPDTFWGEQGKILDWITPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYKELHRDVCRF
ANTLLELGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNS
RLVITSDEGVRAGRSIPLKKNVDDALKNPNVTSVEHVVVLKRTGGKIDWQEGRDLWWHDL
VEQASDQHQAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaattcacaaacacaccattcctgccaacatcgcagaccgttgcctgataaac
cctcagcagtacgaggcgatgtatcaacaatctattaacgcaccagataccttctggggc
gaacagggaaaaattctcgactggatcacaccgtaccagaaggtgaaaaacacctccttt
gcccccggtaatgtgtccattaaatggtacgaggacggcacgctgaatctggcggcaaac
tgccttgaccgccatctgcaagaaaacggcgatcgtaccgccatcatctgggaaggcgac
gacgccagccagagcaaacatatcagctataaagagctgcaccgcgacgtctgccgcttc
gccaataccctgctcgagctgggcattaaaaaaggtgatgtggtggcgatttatatgccg
atggtgccggaagccgcggtcgcgatgctggcctgcgcccgcattggcgcggtgcattcg
gtaattttcggcggcttctcgccggaagccgttgccggacgcattatcgattccaactca
cggttggtgatcacttccgacgaaggtgtgcgtgccgggcgcagcattccactgaagaaa
aacgtcgatgacgcactaaaaaacccgaacgtcaccagcgtagagcatgtggtggtactg
aagcgtactggcgggaaaattgactggcaggaagggcgcgacctgtggtggcacgacctg
gttgagcaagcgagcgatcagcaccaggcggaagagatgaacgccgaagacccgctgttt
attctctatacctccggttctaccggtaagccaaaaggcgtgctgcacactaccggcggt
tatctggtgtacgcggcgctgacctttaaatatgtctttgattatcatccgggcgacatc
tactggtgcaccgccgatgtgggctgggttaccggacacagttatttgctgtatggcccg
ctggcctgcggcgcgaccacgctgatgtttgaaggcgtaccgaactggccgacgcctgcc
cgtatggcgcaagtggtggacaagcatcaggtcaatattctctataccgcgcccacggcg
attcgcgcgctgatggcggaaggcgataaagcgatcgaaggcaccgaccgttcgtcgctg
cgcattctcggttccgtgggcgagccaattaacccggaagcgtgggagtggtactggaag
aagatcggcaacgagaaatgcccggtggtcgacacctggtggcagaccgaaactggcggt
ttcatgatcacgccactgcctggcgctaccgagctgaaagccggttcggcaacacgtccg
ttcttcggcgtgcaaccagcgctggtcgataacgaaggtaacccgctggagggggccacc
gaaggcagtctggtgatcaccgactcctggccgggtcaggcgcgtacgctgtttggcgat
cacgaacgttttgagcagacctacttctccaccttcaaaaatatgtatttcagcggcgac
ggcgcgcgtcgcgatgaagatggctattactggatcaccgggcgcgttgacgacgtgctg
aacgtctccggtcaccgcctggggacggcagagattgagtcggcgctggtggcgcatccg
aaaattgccgaagccgctgtggtcggtattccgcacaatattaaaggtcaggcgatctac
gcctacgtcacgcttaatcacggggaggaaccgtcaccagaactgtacgcagaagtccgc
aactgggtgcgtaaagagattggcccgctggcgacgccagacgtgctgcactggaccgac
tccctgcctaaaacccgctccggcaaaattatgcgccgtattctgcgcaaaattgcggcg
ggcgataccagcaacctgggcgatacctcgacgcttgccgatcctggcgtagtcgagaag
ctgcttgaagagaagcaggccatcgcgatgccatcgtaa

DBGET integrated database retrieval system