KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_4495
Entry
E2348C_4495       CDS       T00796                                 

Gene name
hfq
Definition
(GenBank) HF-I, host factor for RNA phage Q beta replication
  KO
K03666  host factor-I protein
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg02024  Quorum sensing
ecg03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    E2348C_4495 (hfq)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    E2348C_4495 (hfq)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ecg03019]
    E2348C_4495 (hfq)
   03036 Chromosome and associated proteins [BR:ecg03036]
    E2348C_4495 (hfq)
Messenger RNA biogenesis [BR:ecg03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     E2348C_4495 (hfq)
Chromosome and associated proteins [BR:ecg03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    E2348C_4495 (hfq)
SSDB
Motif
Pfam: Hfq LSM
Other DBs
NCBI-ProteinID: CAS12043
UniProt: B7UQI1
Structure
PDB: 

Position
4747672..4747980
AA seq 102 aa
MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS
TVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE
NT seq 309 nt   +upstreamnt  +downstreamnt
atggctaaggggcaatctttacaagatccgttcctgaacgcactgcgtcgggaacgtgtt
ccagtttctatttatttggtgaatggtattaagctgcaaggacaaatcgagtcttttgat
cagttcgtgatcctgttgaaaaacacggtcagccagatggtttacaagcacgcgatttct
actgttgtcccgtctcgcccggtttctcatcacagtaacaacgccggtggcggtaccagc
agtaactatcatcatggtagcagcgcgcagaatacttccgcgcaacaggacagcgaagaa
accgaataa

DBGET integrated database retrieval system