KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348_P1_056
Entry
E2348_P1_056      CDS       T00796                                 
Symbol
traF
Name
(GenBank) putative disulfide-bond-forming protein
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecg02044]
    E2348_P1_056 (traF)
Secretion system [BR:ecg02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   E2348_P1_056 (traF)
SSDB
Motif
Pfam: TraF
Other DBs
NCBI-ProteinID: CAS07492
UniProt: B7UTK2
Position
pMAR2:complement(52952..53713)
AA seq 253 aa
MMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQK
LAALQTATKRALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSARKAMLAHPELDYNLQ
YSHYNGTVRNQLAADQAQQRQAIAKLAEHYGIMFFYRGQDPIDGQLVQVINGFRDTYGLS
VIPVSVDGVINPLLPDSRTDQGQAQRLGVKYFPAMMLVDPKQGSVRPLSYGFISQDDLAK
QFLNVSEDFKPNF
NT seq 762 nt   +upstreamnt  +downstreamnt
gtgatgaaaggaatgaagatgaataaagcattactgccactgttactctgctgctttatt
tttccggcgtcaggaaaagatgcaggctggcagtggtataacgagaaaataaatccgaag
gaaaaagaaaataaacctgtacctgcagccccccgtcaggaaccggatattatgcagaaa
ctggccgcactgcagacggcaacaaagcgggcgctgtacgaagccattctgtatcccggc
gtggataattttgtgaaatatttccggctgcaaaattactggactcagcaggccgggctt
ttcaccatgagcgccagaaaggccatgctggcacatcctgaactggactataacctgcag
tacagccattacaacggcacggtacggaaccagctggcagcagaccaggcgcagcagcga
caggccattgcgaaactggctgaacactacggcatcatgtttttttaccgggggcaggac
cccatcgacgggcaactggtgcaggtcattaatggcttccgggatacgtatggtctgagt
gttattcccgtttccgtggatggcgtgattaatccgctgttgccggattcccggactgac
caggggcaggcgcagcgcctcggcgtgaaatatttcccggccatgatgctggttgacccg
aaacagggcagtgttcgcccgttatcatacggctttatttcgcaggacgacctggcaaaa
cagttcctgaacgtttctgaagattttaaacccaatttttaa

DBGET integrated database retrieval system