KEGG   Ehrlichia chaffeensis Arkansas: ECH_0407Help
Entry
ECH_0407          CDS       T00328                                 

Gene name
tuf-2
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ech  Ehrlichia chaffeensis Arkansas
Brite
KEGG Orthology (KO) [BR:ech00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ech03012]
    ECH_0407 (tuf-2)
   03029 Mitochondrial biogenesis [BR:ech03029]
    ECH_0407 (tuf-2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ech04147]
    ECH_0407 (tuf-2)
Translation factors [BR:ech03012]
 Eukaryotic Type
  Elongation factors
   ECH_0407 (tuf-2)
 Prokaryotic Type
   ECH_0407 (tuf-2)
Mitochondrial biogenesis [BR:ech03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ECH_0407 (tuf-2)
Exosome [BR:ech04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ECH_0407 (tuf-2)
  Exosomal proteins of breast cancer cells
   ECH_0407 (tuf-2)
  Exosomal proteins of colorectal cancer cells
   ECH_0407 (tuf-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: ABD45144
UniProt: Q2GFN6
Position
396752..397939
Genome map
AA seq 395 aa AA seqDB search
MVEERKPHINVGTIGHVDHGKTTLTAALTTVLAKRLSGEGNKSVKYDEIDKAPEEKARGI
TISTAHVEYETENRHYAHVDCPGHADYIKNMITGAAQMDAAILVVSATDGAMPQTREHIL
LAKQVGVKDIVVWMNKCDVVDDEEMLSLVEMEIRELLSKYGYPGDDIDVVRGSAVKALEE
ETGSGVWSEKIMELMNALEKISLPTREKDKPFLMSIEDVFSIPGRGTVVTGRIERGVIRV
GDKIEIVGLRDIQSTVCTGVEMFHKALDAGEAGDNAGILLRGIKKEDVERGQVLSAPGQI
HSYKKFKAEVYILKKEEGGRHTPFFSNYQPQFYVRTTDVTGSIKLPEGVEMVMPGDNISI
EVSLDKPVAIDKGLRFAIREGGRTVGSGIITEILE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggtagaagaaaggaaaccacatataaatgtagggacaatagggcatgttgatcatggt
aagacaacattaacagcagcgttaacaacagtgttagcgaagaggttgagtggagaaggt
aataaaagtgtaaagtatgacgaaatagataaagcaccagaagagaaagcaagaggaata
accatttcaacagcacatgtagaatatgaaacagagaatagacattatgcgcatgtagat
tgtccaggacatgctgattatataaaaaatatgataacaggtgctgcacaaatggatgca
gcaatattagtagtatctgcaacagatggagcaatgccacaaacaagagaacatatacta
ttagcaaaacaagttggagtaaaagatatagtagtatggatgaataagtgtgatgttgta
gatgatgaagaaatgttgtcattagttgagatggaaataagagaattattatcaaaatat
ggatatccaggagatgatatagatgttgtaagaggatctgcagttaaggcattggaagaa
gaaacaggttcaggagtctggagtgaaaaaataatggaattgatgaatgccttagaaaaa
ataagtttaccaacaagagaaaaagataagccatttttaatgtcaatagaagatgtattt
tcaatacctggaagaggtacagtagtaacaggaagaatagagagaggagtaattagagta
ggagataaaatagagatagtagggttacgagatatacagagcacagtatgtacaggtgtt
gaaatgtttcataaagcattagatgcaggagaagcaggggataatgcaggtatattgtta
agaggaataaagaaagaggatgtagagagagggcaagtattgagtgcgcctggtcaaata
cattcgtataagaaatttaaagcagaggtatatatattaaagaaagaagagggaggaagg
catacaccgtttttctcaaattatcagccacaattttatgttagaacaactgatgtaaca
ggtagtataaaattacctgagggggtagagatggtaatgcctggggataatataagtatc
gaagtaagtttagataagcctgttgctattgataaaggattgagatttgcaattcgtgaa
ggtggtagaactgtaggctctggtattattactgaaattttggagtag

DBGET integrated database retrieval system