KEGG   Ehrlichia chaffeensis Arkansas: ECH_0494
Entry
ECH_0494          CDS       T00328                                 

Gene name
virB3
Definition
(GenBank) type IV secretion system protein VirB3
  KO
K03198  type IV secretion system protein VirB3
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ech00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECH_0494 (virB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ech02044]
    ECH_0494 (virB3)
Secretion system [BR:ech02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   ECH_0494 (virB3)
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: ABD44690
UniProt: Q2GGX4
Position
481051..481344
AA seq 97 aa
MAGTVKADQLFKGLTRPTMLFGVSYIFAMLNFMICIMIFMYTNDFRALFILGPGIHSVGF
LASSKEPLFLELFMLRMKKCSKCLNRFYHNANSYDVM
NT seq 294 nt   +upstreamnt  +downstreamnt
atggcaggtactgttaaagcagatcagttatttaagggattaactagacctacgatgctt
tttggtgttagttatatatttgcaatgttgaattttatgatttgtatcatgatatttatg
tatactaatgattttcgtgcattgtttattttaggtccaggaatacattcagtgggtttt
ttagcttcatcaaaagaaccattattcttggagttatttatgctgaggatgaagaagtgt
agtaaatgtttgaatagattttatcataatgctaattcttatgatgtaatgtga

DBGET integrated database retrieval system