KEGG   Ehrlichia chaffeensis Arkansas: ECH_0828Help
Entry
ECH_0828          CDS       T00328                                 

Gene name
dapA
Definition
(GenBank) dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech00261  Monobactam biosynthesis
ech00300  Lysine biosynthesis
ech01100  Metabolic pathways
ech01110  Biosynthesis of secondary metabolites
ech01120  Microbial metabolism in diverse environments
ech01130  Biosynthesis of antibiotics
ech01230  Biosynthesis of amino acids
Module
ech_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ech00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    ECH_0828 (dapA)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    ECH_0828 (dapA)
Enzymes [BR:ech01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     ECH_0828 (dapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-ProteinID: ABD45190
UniProt: Q2GG09
Position
843296..844189
Genome map
AA seq 297 aa AA seqDB search
MYSLMGVFTALITPFKDDFSIDENAFCHLIEEQISNNIHGLVPCGTTAECPTLSFEEYCK
VIELCVKITNKRVPIIAGSSSNSTQEAIKRTLYVQSLNVDAALVVVPYYNRPSDEGIYQH
FKAVHDATNLPIIAYNIPNRSAIDASDALLARILSLPRIIGLKDSTGDVSRPLNLKLLLN
KEVVLFSGDDSTCLGFYAQSGSGGRTGCISVVSNVIPKIHADMHNAFLANNMKEAMNANL
SVFKLAKALFCQSSPAPTKYAMSLIKNISPAVRLPLVELTQENKLKVEKTLKELKLI
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtacagccttatgggtgtttttacggcattaattacaccatttaaggatgatttttct
atagatgaaaacgcgttttgtcatctaattgaagaacaaatcagtaataatattcatggt
ttagttccatgcggcactactgcagaatgtcctactttaagctttgaagagtactgcaaa
gtaatcgaattatgtgttaaaatcacaaataaacgtgtccccataatagctggatcaagc
tcaaattctacacaagaagctattaaacgcacgttatatgttcagtctctaaatgtagat
gcagctttagtagttgtaccatattacaatagaccaagtgatgaaggaatatatcaacat
tttaaagcagtacatgatgcaactaaccttcccattattgcatataatatacctaataga
tctgctattgatgcaagcgatgcattacttgcacgaattttatctttgcctagaataata
gggcttaaagattcaactggagatgtaagtaggcctcttaatttaaaattattactaaat
aaagaagtagttttattctcaggtgatgattctacatgcttagggttctatgctcaaagt
ggtagtggtggtaggactggatgcatttctgttgtttcaaatgtgatacctaaaatacat
gctgatatgcacaatgcattccttgctaataatatgaaagaagctatgaatgcaaattta
tcagtatttaaattagcaaaagcattgttttgtcagtcaagccctgcaccaacaaaatat
gctatgagcttaattaaaaatatctcaccagcagtaaggttgccattagtggaattaact
caagaaaacaaattaaaagttgaaaaaacgctaaaagaattaaagttaatttaa

DBGET integrated database retrieval system