KEGG   Ehrlichia chaffeensis Arkansas: ECH_0829Help
Entry
ECH_0829          CDS       T00328                                 

Definition
(GenBank) hypothetical protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABD44703
UniProt: Q2GG08
Position
complement(844186..844323)
Genome map
AA seq 45 aa AA seqDB search
MKGAVKLILHYIPHQYTMSSILDNKKHNIQTTNAYYHNPRLLNMS
NT seq 138 nt NT seq  +upstreamnt  +downstreamnt
ttgaagggagctgtgaaacttatactgcattatattccacatcaatataccatgtcaagc
atattagataataaaaagcataatatacaaactaccaacgcttattaccataaccccagg
ttattgaatatgtcttaa

DBGET integrated database retrieval system