KEGG   Ehrlichia chaffeensis Arkansas: ECH_0832Help
Entry
ECH_0832          CDS       T00328                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech00020  Citrate cycle (TCA cycle)
ech00310  Lysine degradation
ech01100  Metabolic pathways
ech01110  Biosynthesis of secondary metabolites
ech01120  Microbial metabolism in diverse environments
ech01130  Biosynthesis of antibiotics
ech01200  Carbon metabolism
Module
ech_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ech_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ech00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECH_0832 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    ECH_0832 (sucA)
   00380 Tryptophan metabolism
    ECH_0832 (sucA)
Enzymes [BR:ech01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     ECH_0832 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: ABD45486
UniProt: Q2GG05
Position
complement(846139..848877)
Genome map
AA seq 912 aa AA seqDB search
MKGVTCLFTDNVDVIEDIYRCYQKDSNSVSLEWRNFFSNNLHLSENINAIDQSKSLDLID
NCNAKIVELLNFFRSYGHTAADLDPLKLHVASDLDYHEYIDLGDIKPSTTFNSVLGLHNP
TLDDIINTLKSIYCNKLGYEFMHIRNHEERLWLQNKIESFCNGISNDEKKKILQHLMEVE
CFEQLLHTRYPGYKRFSVEGGDSLIVAIEQMIDLSAVYNFREIVIGMAHRGRLSVLTKVM
KKPYRAMIYEFKGGTAYPKDIDVSGDVKYHLGYSSDRQLSSNKTVHLSLCPNPSHLESVN
PVVMGKIRAKQDVLEECDKSSIFGVLVHGDASVIGQGVVAETLTLSNLAGYEIRGVVHIV
VNNQIGFTTDPKDSRSSFYCSDVAKLIDAPVFHVNGDSPEDVVAAVKLAIEYREKFNKDV
VIDIVCYRRYGHNEGDEPLFTQPVMYDCIMKHKTPMTLYKEQLISESVITEEEFKILKAK
FNSMLNEEFVQSENYVPDQADWLKGNWTNFRRPVPGNFADYLSDTRVDEQKLLKLAHALV
DVPKEFNGNKKILRVLSTRFDMVSSGENIDWATGEALAFASLLSENIKVRLSGQDCGRGT
FSHRHAVLVDQVTGSTYIPLNNLGVPQASFEVLNSPLSEYAVMGFEYGYSTNSPAALVIW
EGQFGDFANGAQIIVDQFISSAETKWLRCSGLVLLLPHGYEGQGPEHSSARIERYLQLCA
EDNMQVVNCTTPASYFHVLRRQICRDFRKPLVVFTPKSLLRHKMAVSKLSDFAGSFIPVI
GEVYPLCSNEKVRRVVICSGKVYFDIIEARDKRKIDNIAVIRLEQYYPFPEEQLANELRN
YQNAEVVWCQEEPMNMGAWLFVNSYIEKVLMKINVQSKRPICVSRPASAATAAGYASMHS
KEQDDVLLHVLS
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtgtaacttgtttatttactgataatgtagatgttatagaagatatttatagg
tgttatcaaaaggatagtaattctgtttctctagagtggcgtaattttttttctaataac
ttgcatttatcggaaaatattaatgctatcgaccaatcaaagagtctggatcttattgat
aactgtaatgctaaaattgtagaattattaaacttttttaggtcttatggacatactgct
gctgatttagatcctttaaagttgcatgtagccagtgatttagattatcatgaatatatt
gatttaggtgatatcaagccttccaccacatttaattctgtattaggattacataaccct
actttagatgacataattaatactttgaaatctatttattgtaataaacttggctatgag
tttatgcatattagaaatcatgaagaaaggctatggttacaaaacaagattgaaagtttt
tgtaacggaatatcaaatgatgaaaagaagaaaatattgcaacatttaatggaagtagaa
tgttttgaacagttacttcatactagatatcccggatacaagagattttctgtcgaagga
ggagattctttgattgttgctattgaacaaatgattgacttgtcagctgtgtacaatttc
cgtgagatagtaattggtatggcgcatcgtggaagattgagcgtgttaacaaaggtcatg
aaaaagccatatagggctatgatatatgaatttaaaggaggaactgcatatccaaaggat
atagatgtttctggtgatgttaaatatcatttaggttattcttctgatcgtcaattatct
tccaataaaactgtacatttgtctttatgtcctaatccttctcatctagaatctgtcaat
ccagttgttatggggaaaattagagcaaaacaagatgtattagaagaatgtgataaatct
tctatatttggagtattagtacatggagatgcttctgttattggtcaaggtgttgttgca
gaaacattaactttgagtaatttggcaggatatgagattcgtggtgtggtacatatagta
gttaataatcaaataggttttacgacagatcctaaagattctagatcttctttctattgt
tcagatgtcgcaaaattaatagatgctccagtttttcatgtaaatggtgattctcctgaa
gatgtagtagcagctgttaagctagctatagagtatagggagaaatttaacaaagatgtg
gtaatcgatatagtatgctatcgtcgttatgggcataatgaaggtgatgagcctttgttt
actcaacctgtcatgtatgactgtattatgaagcataaaactcctatgactctttataag
gagcagctaattagtgaaagtgtcattacagaggaagaattcaaaatcttgaaagctaaa
tttaatagtatgcttaatgaagagtttgtacagtcagagaactatgttcctgatcaagct
gattggttaaagggaaattggactaattttagaagacctgtacctggtaattttgcagat
tatttatctgacacaagggtagatgaacaaaagttattaaaattagcccatgcattagtg
gatgttcctaaagagtttaatgggaataaaaaaatattaagggtgttatctacacgtttt
gatatggtatcttctggtgaaaatattgattgggcaactggtgaagcgttagcttttgca
tctttgttatcggaaaatattaaggtcaggttatctggtcaagattgtggtagaggtaca
ttctcacatagacatgcagtgttagtggatcaggttacaggaagtacttatattcctttg
aataatttaggagtgccacaagcaagttttgaagttcttaatagcccattatcagaatat
gcagttatgggatttgagtatggatatagtactaattctcctgcagctttagttatatgg
gaagggcaatttggagattttgctaatggtgcacagattattgttgatcagtttatttct
tctgcagaaactaagtggttacgctgtagtggattagtgttattacttcctcatggatat
gaaggtcaaggtcctgaacatagttcagcaagaatagaaaggtatttacaattatgtgca
gaagataacatgcaagttgtaaactgtacaactcctgcaagttattttcatgtattacgt
agacaaatatgtagagattttcgtaaacctcttgttgtgtttactccaaagtctttgtta
cgtcataaaatggcagtatcaaagttatcagattttgctggatcttttattcctgtaatt
ggtgaagtatacccattatgtagtaatgagaaagttcgtagagttgtaatatgtagtggt
aaagtatattttgatataattgaggctcgagataaacgaaaaatagataatatagcagta
atacgtttagaacagtattatccttttccagaagaacaactagcaaatgaactaagaaat
tatcagaatgcagaggtagtttggtgtcaggaagagccgatgaatatgggagcgtggcta
tttgttaatagttatattgaaaaggttttaatgaaaatcaatgtacaatctaagcgacca
atatgtgtttcccgtcctgcttctgctgctactgcagctggatatgcgagtatgcatagt
aaggaacaggatgatgttttgttgcatgtgttaagttga

DBGET integrated database retrieval system