KEGG   Ehrlichia chaffeensis Arkansas: ECH_0835Help
Entry
ECH_0835          CDS       T00328                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2163 Phage_BR0599
Motif
Other DBs
NCBI-ProteinID: ABD45134
UniProt: Q2GG02
Position
849663..850478
Genome map
AA seq 271 aa AA seqDB search
MKNIDPELKQHLSSEVLTIAYCLQIILQNKKIIGLTNFDQNLIIDNITYETTPGLNIDIL
KYDAISGNSTKIETTINSNIIKEEEILSGLYDFATVKIFFVNYTNLTQGSAILFHGNIDK
IILNNDKFTAEVKSTFNILSRNIGDLFSSSCRAQFCDNKCKLNKEAFTNIHSITRVVSNQ
EFECINLINIDNYYTYGSIVFITGKNSNLTLEIQVHNKSYIKLYTPTPYKISINDRFSIV
AGCDKSFTTCSNRFNNGKNFRGEPHIPEIHF
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacattgatcctgaattaaaacaacatctatcatctgaagttctgactattgca
tactgcttacaaattattctacaaaacaaaaaaataatagggttgaccaactttgatcaa
aacttaatcatagataacataacctatgaaacaacacctgggttaaacatagacatatta
aaatatgacgctatttctggtaatagcacaaaaatagaaacaaccataaatagcaacata
ataaaagaagaagaaatattatctggattatatgattttgctacagtaaaaatatttttt
gtaaattatacaaacctaactcaaggcagtgcaatattatttcatggaaacattgataag
ataattctaaacaatgataaatttacagcagaagttaagagcacatttaacattctatct
agaaacataggcgaccttttttcatcttcatgtcgagcacaattctgtgataataagtgc
aaattaaacaaagaagcatttactaatatacacagtattactagagtagtaagtaatcaa
gaatttgaatgtatcaacttaataaacattgataactactatacatacggatcaattgtg
ttcattacaggaaaaaacagtaatttaacactagaaatccaagtccacaataaatcatat
ataaaactttacacccctactccatataaaatctcaattaatgatagattctccatagtt
gctggttgtgataaaagttttactacatgtagtaacagatttaacaatggtaaaaatttc
cggggagaaccacatattcctgaaatacatttttaa

DBGET integrated database retrieval system